BLASTX nr result
ID: Glycyrrhiza24_contig00032695
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00032695 (259 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003612765.1| hypothetical protein MTR_5g028700 [Medicago ... 58 9e-07 ref|XP_003612747.1| Ankyrin-like protein [Medicago truncatula] g... 56 3e-06 >ref|XP_003612765.1| hypothetical protein MTR_5g028700 [Medicago truncatula] gi|355514100|gb|AES95723.1| hypothetical protein MTR_5g028700 [Medicago truncatula] Length = 909 Score = 57.8 bits (138), Expect = 9e-07 Identities = 25/50 (50%), Positives = 37/50 (74%) Frame = +2 Query: 110 IAYLLVQIFKWLNIFGIRRIYDQECTHYEVLGILKCFQKRIASLTELEIR 259 +AYLLVQ+F +L+I GIR+IYDQ+ THYEV+GIL F + + +++ Sbjct: 512 VAYLLVQVFHYLDINGIRKIYDQKYTHYEVIGILSYFCRSVGKFNSSKLK 561 >ref|XP_003612747.1| Ankyrin-like protein [Medicago truncatula] gi|355514082|gb|AES95705.1| Ankyrin-like protein [Medicago truncatula] Length = 394 Score = 56.2 bits (134), Expect = 3e-06 Identities = 26/50 (52%), Positives = 35/50 (70%) Frame = +2 Query: 107 RIAYLLVQIFKWLNIFGIRRIYDQECTHYEVLGILKCFQKRIASLTELEI 256 RIAYL ++ F LNIFG+RRIY+ + THYEV+GIL F + I + E+ Sbjct: 33 RIAYLFIRCFNCLNIFGVRRIYELKYTHYEVIGILGYFCQSIGEFSSREL 82