BLASTX nr result
ID: Glycyrrhiza24_contig00032686
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00032686 (296 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFP97615.1| frigida-like protein [Medicago sativa] 59 3e-07 gb|ACJ85672.1| unknown [Medicago truncatula] 58 7e-07 >gb|AFP97615.1| frigida-like protein [Medicago sativa] Length = 519 Score = 59.3 bits (142), Expect = 3e-07 Identities = 30/39 (76%), Positives = 32/39 (82%), Gaps = 1/39 (2%) Frame = -1 Query: 248 KLKSFILRMDALGFWGLMIG-KKELEGLRAEMLVVLSEC 135 KLKSF L+MDALGFWG +IG KKELEGLRAEM L EC Sbjct: 126 KLKSFCLKMDALGFWGFVIGKKKELEGLRAEMPEALGEC 164 >gb|ACJ85672.1| unknown [Medicago truncatula] Length = 353 Score = 58.2 bits (139), Expect = 7e-07 Identities = 29/39 (74%), Positives = 32/39 (82%), Gaps = 1/39 (2%) Frame = -1 Query: 248 KLKSFILRMDALGFWGLMIG-KKELEGLRAEMLVVLSEC 135 KLKSF L+MDALGFWG ++G KKELEGLRAEM L EC Sbjct: 126 KLKSFCLKMDALGFWGFVMGKKKELEGLRAEMPEALGEC 164