BLASTX nr result
ID: Glycyrrhiza24_contig00032577
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00032577 (251 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003551145.1| PREDICTED: uncharacterized protein LOC100775... 133 1e-29 ref|XP_003545561.1| PREDICTED: uncharacterized protein LOC100783... 130 8e-29 emb|CBI20804.3| unnamed protein product [Vitis vinifera] 129 2e-28 ref|XP_002280927.1| PREDICTED: uncharacterized protein LOC100262... 129 2e-28 ref|XP_002527998.1| conserved hypothetical protein [Ricinus comm... 129 2e-28 >ref|XP_003551145.1| PREDICTED: uncharacterized protein LOC100775945 [Glycine max] Length = 454 Score = 133 bits (335), Expect = 1e-29 Identities = 63/83 (75%), Positives = 72/83 (86%) Frame = +3 Query: 3 ELQKAFRYLACIILPSLFVELAHKTLLFWRVRISVPHVTPGLLLNSVVFFLMLVSWVYRT 182 EL+KAFRYL CIILP LFVELAHK + F V+ S PH++PGL LNS+VF L+L+SW+YRT Sbjct: 170 ELEKAFRYLTCIILPCLFVELAHKIIFFSAVKFSAPHISPGLPLNSIVFVLVLLSWLYRT 229 Query: 183 GVFLLVCVLFRLTCELQILRFEG 251 GVFLLVCVLFRLTCELQ LRFEG Sbjct: 230 GVFLLVCVLFRLTCELQKLRFEG 252 >ref|XP_003545561.1| PREDICTED: uncharacterized protein LOC100783743 [Glycine max] Length = 455 Score = 130 bits (328), Expect = 8e-29 Identities = 63/83 (75%), Positives = 71/83 (85%) Frame = +3 Query: 3 ELQKAFRYLACIILPSLFVELAHKTLLFWRVRISVPHVTPGLLLNSVVFFLMLVSWVYRT 182 EL+KAFRYL IILPS F+ELAHK + F V+IS PH++PG LNS+VF L+LVSWVYRT Sbjct: 169 ELEKAFRYLTYIILPSFFMELAHKIIFFSAVKISAPHISPGFPLNSIVFVLVLVSWVYRT 228 Query: 183 GVFLLVCVLFRLTCELQILRFEG 251 GVFLLVCVLFRLTCELQ LRFEG Sbjct: 229 GVFLLVCVLFRLTCELQKLRFEG 251 >emb|CBI20804.3| unnamed protein product [Vitis vinifera] Length = 435 Score = 129 bits (325), Expect = 2e-28 Identities = 62/83 (74%), Positives = 71/83 (85%) Frame = +3 Query: 3 ELQKAFRYLACIILPSLFVELAHKTLLFWRVRISVPHVTPGLLLNSVVFFLMLVSWVYRT 182 EL KAFR+LA I+LPSLFVELAHK L F VRIS+PH+ G+ LNS+ F L+L SW+YRT Sbjct: 161 ELDKAFRFLAFILLPSLFVELAHKILFFSTVRISIPHIPSGVPLNSIAFVLVLASWIYRT 220 Query: 183 GVFLLVCVLFRLTCELQILRFEG 251 G+FLLVCVLFRLTCELQILRFEG Sbjct: 221 GLFLLVCVLFRLTCELQILRFEG 243 >ref|XP_002280927.1| PREDICTED: uncharacterized protein LOC100262807 [Vitis vinifera] Length = 460 Score = 129 bits (325), Expect = 2e-28 Identities = 62/83 (74%), Positives = 71/83 (85%) Frame = +3 Query: 3 ELQKAFRYLACIILPSLFVELAHKTLLFWRVRISVPHVTPGLLLNSVVFFLMLVSWVYRT 182 EL KAFR+LA I+LPSLFVELAHK L F VRIS+PH+ G+ LNS+ F L+L SW+YRT Sbjct: 161 ELDKAFRFLAFILLPSLFVELAHKILFFSTVRISIPHIPSGVPLNSIAFVLVLASWIYRT 220 Query: 183 GVFLLVCVLFRLTCELQILRFEG 251 G+FLLVCVLFRLTCELQILRFEG Sbjct: 221 GLFLLVCVLFRLTCELQILRFEG 243 >ref|XP_002527998.1| conserved hypothetical protein [Ricinus communis] gi|223532624|gb|EEF34410.1| conserved hypothetical protein [Ricinus communis] Length = 436 Score = 129 bits (325), Expect = 2e-28 Identities = 62/83 (74%), Positives = 72/83 (86%) Frame = +3 Query: 3 ELQKAFRYLACIILPSLFVELAHKTLLFWRVRISVPHVTPGLLLNSVVFFLMLVSWVYRT 182 EL KAFRYLACI+LPS FVELAHK + F V I++P+++ G+ LNSV+F L+L SWVYRT Sbjct: 154 ELDKAFRYLACILLPSFFVELAHKIIFFSTVEITLPYISLGVPLNSVMFLLVLASWVYRT 213 Query: 183 GVFLLVCVLFRLTCELQILRFEG 251 GVFLLVCVLFRLTCELQILRFEG Sbjct: 214 GVFLLVCVLFRLTCELQILRFEG 236