BLASTX nr result
ID: Glycyrrhiza24_contig00032501
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00032501 (228 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003605825.1| NBS/LRR resistance protein-like protein [Med... 110 2e-22 emb|CBI40678.3| unnamed protein product [Vitis vinifera] 78 7e-13 ref|XP_002265391.1| PREDICTED: putative disease resistance RPP13... 78 7e-13 emb|CAN75510.1| hypothetical protein VITISV_035099 [Vitis vinifera] 77 1e-12 ref|XP_002269571.2| PREDICTED: putative disease resistance prote... 77 2e-12 >ref|XP_003605825.1| NBS/LRR resistance protein-like protein [Medicago truncatula] gi|355506880|gb|AES88022.1| NBS/LRR resistance protein-like protein [Medicago truncatula] Length = 474 Score = 110 bits (274), Expect = 2e-22 Identities = 51/61 (83%), Positives = 56/61 (91%) Frame = -1 Query: 183 LSHYDITNLPASIGRLSHLCYLDLSYTALQALPDSVCDLLNLQTLMLTNCSSLTSFPPRM 4 LSHYDIT LP SIGRLS+LCYLDLS+TAL+ LPDS+CDL NLQTLMLTNC SLTSFPPR+ Sbjct: 382 LSHYDITYLPNSIGRLSNLCYLDLSHTALETLPDSICDLCNLQTLMLTNCRSLTSFPPRI 441 Query: 3 C 1 C Sbjct: 442 C 442 >emb|CBI40678.3| unnamed protein product [Vitis vinifera] Length = 1243 Score = 78.2 bits (191), Expect = 7e-13 Identities = 38/60 (63%), Positives = 43/60 (71%) Frame = -1 Query: 183 LSHYDITNLPASIGRLSHLCYLDLSYTALQALPDSVCDLLNLQTLMLTNCSSLTSFPPRM 4 LSHY IT L SIG L L YLDLSYT L+ LPDS C+L NLQTL+L+NC SL+ P M Sbjct: 561 LSHYKITELSDSIGNLRKLAYLDLSYTGLRNLPDSTCNLYNLQTLLLSNCCSLSELPANM 620 >ref|XP_002265391.1| PREDICTED: putative disease resistance RPP13-like protein 1 [Vitis vinifera] Length = 1308 Score = 78.2 bits (191), Expect = 7e-13 Identities = 38/60 (63%), Positives = 43/60 (71%) Frame = -1 Query: 183 LSHYDITNLPASIGRLSHLCYLDLSYTALQALPDSVCDLLNLQTLMLTNCSSLTSFPPRM 4 LSHY IT L SIG L L YLDLSYT L+ LPDS C+L NLQTL+L+NC SL+ P M Sbjct: 582 LSHYKITELSDSIGNLRKLAYLDLSYTGLRNLPDSTCNLYNLQTLLLSNCCSLSELPANM 641 >emb|CAN75510.1| hypothetical protein VITISV_035099 [Vitis vinifera] Length = 1335 Score = 77.4 bits (189), Expect = 1e-12 Identities = 37/57 (64%), Positives = 45/57 (78%) Frame = -1 Query: 183 LSHYDITNLPASIGRLSHLCYLDLSYTALQALPDSVCDLLNLQTLMLTNCSSLTSFP 13 LSHY IT+LP SIG+L HL YLDLSYTA+ LP+S+ L NLQTLML+NC+ L+ P Sbjct: 586 LSHYHITHLPDSIGKLKHLRYLDLSYTAIHKLPESIGMLFNLQTLMLSNCNFLSEVP 642 >ref|XP_002269571.2| PREDICTED: putative disease resistance protein At3g14460-like [Vitis vinifera] Length = 1330 Score = 76.6 bits (187), Expect = 2e-12 Identities = 36/60 (60%), Positives = 45/60 (75%) Frame = -1 Query: 183 LSHYDITNLPASIGRLSHLCYLDLSYTALQALPDSVCDLLNLQTLMLTNCSSLTSFPPRM 4 L+HY I LP SIG L HL YLDLS T+++ LP+S+ +L NLQTLML+NC SLT P +M Sbjct: 599 LAHYHIVELPRSIGTLKHLRYLDLSRTSIRRLPESITNLFNLQTLMLSNCHSLTHLPTKM 658