BLASTX nr result
ID: Glycyrrhiza24_contig00032486
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00032486 (316 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003589826.1| Pentatricopeptide repeat-containing protein ... 85 7e-15 ref|XP_003556973.1| PREDICTED: pentatricopeptide repeat-containi... 62 6e-08 >ref|XP_003589826.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355478874|gb|AES60077.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 526 Score = 84.7 bits (208), Expect = 7e-15 Identities = 41/51 (80%), Positives = 44/51 (86%) Frame = +3 Query: 3 DTGVAKVPAVSFIEVNNRVYEFIAGDKSNIYFVGIFDVLHSLDGQLKIEDH 155 D GV KVP VSFIEVNN VYEFIAGDK +IYFV I+DVLHSLDGQ+KIE H Sbjct: 476 DAGVEKVPGVSFIEVNNIVYEFIAGDKLSIYFVDIYDVLHSLDGQIKIEIH 526 >ref|XP_003556973.1| PREDICTED: pentatricopeptide repeat-containing protein At5g56310-like [Glycine max] Length = 549 Score = 61.6 bits (148), Expect = 6e-08 Identities = 34/50 (68%), Positives = 39/50 (78%) Frame = +3 Query: 3 DTGVAKVPAVSFIEVNNRVYEFIAGDKSNIYFVGIFDVLHSLDGQLKIED 152 DT KVP VSF+E+NNRVYEFIAGDK NI F+ DVL S++GQL IED Sbjct: 494 DTCAEKVPGVSFVELNNRVYEFIAGDKLNICFL---DVLQSINGQL-IED 539