BLASTX nr result
ID: Glycyrrhiza24_contig00032462
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00032462 (255 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003540386.1| PREDICTED: pentatricopeptide repeat-containi... 137 1e-30 ref|XP_002278909.1| PREDICTED: pentatricopeptide repeat-containi... 120 1e-25 ref|XP_002892331.1| pentatricopeptide repeat-containing protein ... 100 1e-19 ref|NP_563765.1| pentatricopeptide repeat-containing protein [Ar... 100 1e-19 ref|XP_004139374.1| PREDICTED: pentatricopeptide repeat-containi... 97 1e-18 >ref|XP_003540386.1| PREDICTED: pentatricopeptide repeat-containing protein At1g06270-like [Glycine max] Length = 342 Score = 137 bits (344), Expect = 1e-30 Identities = 64/69 (92%), Positives = 66/69 (95%) Frame = +3 Query: 48 HPLPLALAVLQRTLRSGCVPVPQTLVLLSSAWLDRRCLSHSVANILLEMQSIGYHPDCGT 227 HP PLALAVLQRTLRSGCVPVPQT VLLSSAWLD+ CLSHSVANILL+MQSIGYHPDCGT Sbjct: 113 HPFPLALAVLQRTLRSGCVPVPQTHVLLSSAWLDQHCLSHSVANILLQMQSIGYHPDCGT 172 Query: 228 CNYLLSSLC 254 CNYLLSSLC Sbjct: 173 CNYLLSSLC 181 >ref|XP_002278909.1| PREDICTED: pentatricopeptide repeat-containing protein At1g06270 [Vitis vinifera] gi|302143379|emb|CBI21940.3| unnamed protein product [Vitis vinifera] Length = 343 Score = 120 bits (301), Expect = 1e-25 Identities = 56/69 (81%), Positives = 63/69 (91%) Frame = +3 Query: 48 HPLPLALAVLQRTLRSGCVPVPQTLVLLSSAWLDRRCLSHSVANILLEMQSIGYHPDCGT 227 +PLPLALA+LQRTLRSGC+PVPQT +LLSSAWL RR SHSV+NIL EMQSIGY+PDCGT Sbjct: 114 NPLPLALAILQRTLRSGCIPVPQTHLLLSSAWLSRRRQSHSVSNILSEMQSIGYYPDCGT 173 Query: 228 CNYLLSSLC 254 CNYL+ SLC Sbjct: 174 CNYLILSLC 182 >ref|XP_002892331.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297338173|gb|EFH68590.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 343 Score = 100 bits (250), Expect = 1e-19 Identities = 48/68 (70%), Positives = 57/68 (83%) Frame = +3 Query: 51 PLPLALAVLQRTLRSGCVPVPQTLVLLSSAWLDRRCLSHSVANILLEMQSIGYHPDCGTC 230 PLPL+ A+LQRTLRSGC+P PQT +LLS AWL+RR S SVA+I+ EM+ IGY PD GTC Sbjct: 115 PLPLSFAILQRTLRSGCLPNPQTQLLLSDAWLERRRGSQSVADIINEMKLIGYSPDTGTC 174 Query: 231 NYLLSSLC 254 NYL+SSLC Sbjct: 175 NYLVSSLC 182 >ref|NP_563765.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75264068|sp|Q9LNC0.1|PPR16_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At1g06270 gi|8844132|gb|AAF80224.1|AC025290_13 Contains similarity to an unknown protein F23N19.4 gi|6630464 from Arabidopsis thaliana gb|AC007190 and contains multiple PPR PF|01535 repeats. EST gb|T44174 comes from this gene [Arabidopsis thaliana] gi|17529194|gb|AAL38823.1| unknown protein [Arabidopsis thaliana] gi|20465473|gb|AAM20196.1| unknown protein [Arabidopsis thaliana] gi|21536601|gb|AAM60933.1| unknown [Arabidopsis thaliana] gi|332189849|gb|AEE27970.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 343 Score = 100 bits (249), Expect = 1e-19 Identities = 48/68 (70%), Positives = 57/68 (83%) Frame = +3 Query: 51 PLPLALAVLQRTLRSGCVPVPQTLVLLSSAWLDRRCLSHSVANILLEMQSIGYHPDCGTC 230 PLPL+ A+LQRTLRSGC+P PQT +LLS AWL+RR S SVA+I+ EM+ IGY PD GTC Sbjct: 115 PLPLSFAILQRTLRSGCLPNPQTHLLLSDAWLERRRGSQSVADIINEMKLIGYSPDTGTC 174 Query: 231 NYLLSSLC 254 NYL+SSLC Sbjct: 175 NYLVSSLC 182 >ref|XP_004139374.1| PREDICTED: pentatricopeptide repeat-containing protein At1g06270-like [Cucumis sativus] gi|449483078|ref|XP_004156487.1| PREDICTED: pentatricopeptide repeat-containing protein At1g06270-like [Cucumis sativus] Length = 343 Score = 97.4 bits (241), Expect = 1e-18 Identities = 47/68 (69%), Positives = 53/68 (77%) Frame = +3 Query: 51 PLPLALAVLQRTLRSGCVPVPQTLVLLSSAWLDRRCLSHSVANILLEMQSIGYHPDCGTC 230 P PL+L VLQR L SGCVP PQT LLSSAWL +R + SVANIL++MQSIGY PD C Sbjct: 115 PFPLSLPVLQRILHSGCVPSPQTHFLLSSAWLKQRSQAKSVANILMDMQSIGYKPDSNIC 174 Query: 231 NYLLSSLC 254 NYL+SSLC Sbjct: 175 NYLISSLC 182