BLASTX nr result
ID: Glycyrrhiza24_contig00032449
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00032449 (267 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003621733.1| Coiled-coil domain-containing protein MTMR15... 72 5e-11 ref|XP_004141651.1| PREDICTED: fanconi-associated nuclease 1 hom... 67 2e-09 ref|XP_003551811.1| PREDICTED: fanconi-associated nuclease 1 hom... 67 2e-09 ref|XP_002518227.1| conserved hypothetical protein [Ricinus comm... 63 2e-08 emb|CBI39437.3| unnamed protein product [Vitis vinifera] 63 3e-08 >ref|XP_003621733.1| Coiled-coil domain-containing protein MTMR15 [Medicago truncatula] gi|355496748|gb|AES77951.1| Coiled-coil domain-containing protein MTMR15 [Medicago truncatula] Length = 922 Score = 72.0 bits (175), Expect = 5e-11 Identities = 31/34 (91%), Positives = 34/34 (100%) Frame = -2 Query: 266 VKGPRDRLSEQQRAWLLLLMDCGFMIEVCKVKPL 165 VKGP+DRLSEQQRAWLL+LMDCGFM+EVCKVKPL Sbjct: 889 VKGPKDRLSEQQRAWLLMLMDCGFMVEVCKVKPL 922 >ref|XP_004141651.1| PREDICTED: fanconi-associated nuclease 1 homolog [Cucumis sativus] gi|449506836|ref|XP_004162862.1| PREDICTED: fanconi-associated nuclease 1 homolog [Cucumis sativus] Length = 949 Score = 66.6 bits (161), Expect = 2e-09 Identities = 28/33 (84%), Positives = 32/33 (96%) Frame = -2 Query: 266 VKGPRDRLSEQQRAWLLLLMDCGFMIEVCKVKP 168 VKGP+DRLSEQQRAW+LLLMDCGF+IEVCK+ P Sbjct: 916 VKGPKDRLSEQQRAWILLLMDCGFIIEVCKITP 948 >ref|XP_003551811.1| PREDICTED: fanconi-associated nuclease 1 homolog [Glycine max] Length = 981 Score = 66.6 bits (161), Expect = 2e-09 Identities = 31/34 (91%), Positives = 32/34 (94%) Frame = -2 Query: 266 VKGPRDRLSEQQRAWLLLLMDCGFMIEVCKVKPL 165 VKGPRDRLSEQQRAWLLLL+D GF IEVCKVKPL Sbjct: 948 VKGPRDRLSEQQRAWLLLLLDYGFTIEVCKVKPL 981 >ref|XP_002518227.1| conserved hypothetical protein [Ricinus communis] gi|223542632|gb|EEF44170.1| conserved hypothetical protein [Ricinus communis] Length = 188 Score = 63.2 bits (152), Expect = 2e-08 Identities = 27/34 (79%), Positives = 31/34 (91%) Frame = -2 Query: 266 VKGPRDRLSEQQRAWLLLLMDCGFMIEVCKVKPL 165 VKGP+D LSEQQ+AWLLLLMDCGF EVCKV+P+ Sbjct: 151 VKGPKDSLSEQQQAWLLLLMDCGFSTEVCKVRPM 184 >emb|CBI39437.3| unnamed protein product [Vitis vinifera] Length = 951 Score = 62.8 bits (151), Expect = 3e-08 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -2 Query: 266 VKGPRDRLSEQQRAWLLLLMDCGFMIEVCKVKP 168 VKGPRDRLSEQQRAWLLLLMD GF +EVCKV P Sbjct: 916 VKGPRDRLSEQQRAWLLLLMDYGFNVEVCKVGP 948