BLASTX nr result
ID: Glycyrrhiza24_contig00032442
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00032442 (253 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003538665.1| PREDICTED: pentatricopeptide repeat-containi... 139 3e-31 ref|XP_002275236.2| PREDICTED: pentatricopeptide repeat-containi... 133 1e-29 emb|CAN76112.1| hypothetical protein VITISV_005527 [Vitis vinifera] 133 1e-29 ref|XP_002327945.1| predicted protein [Populus trichocarpa] gi|2... 133 2e-29 ref|XP_002519997.1| pentatricopeptide repeat-containing protein,... 132 4e-29 >ref|XP_003538665.1| PREDICTED: pentatricopeptide repeat-containing protein At3g18110, chloroplastic-like [Glycine max] Length = 1476 Score = 139 bits (349), Expect = 3e-31 Identities = 67/84 (79%), Positives = 73/84 (86%) Frame = -2 Query: 252 KKMNKFALRPEKNWRERVNFLTDRILGLKPEESVTDVLEERRVQMLTPTDFCFVVKSVGQ 73 KKMNK AL+ +KNWRERV +LTD IL LK EE V VLEERRVQM TPTDFCFVVK VGQ Sbjct: 134 KKMNKLALKRDKNWRERVKYLTDTILALKSEEFVAGVLEERRVQM-TPTDFCFVVKWVGQ 192 Query: 72 RSWQRALELYECLNLRHWYSPNAR 1 ++WQRALELYECLNLRHWY+PNAR Sbjct: 193 QNWQRALELYECLNLRHWYAPNAR 216 >ref|XP_002275236.2| PREDICTED: pentatricopeptide repeat-containing protein At3g18110, chloroplastic-like [Vitis vinifera] Length = 1442 Score = 133 bits (335), Expect = 1e-29 Identities = 65/84 (77%), Positives = 72/84 (85%) Frame = -2 Query: 252 KKMNKFALRPEKNWRERVNFLTDRILGLKPEESVTDVLEERRVQMLTPTDFCFVVKSVGQ 73 KKM K AL+ K+WR+RV FLTDRILGLK EE V DVL++R+VQM TPTDFCFVVK VGQ Sbjct: 107 KKMTKLALKRAKDWRQRVQFLTDRILGLKSEEFVADVLDDRKVQM-TPTDFCFVVKWVGQ 165 Query: 72 RSWQRALELYECLNLRHWYSPNAR 1 SWQRALE+YE LNLRHWYSPNAR Sbjct: 166 SSWQRALEVYEWLNLRHWYSPNAR 189 >emb|CAN76112.1| hypothetical protein VITISV_005527 [Vitis vinifera] Length = 1494 Score = 133 bits (335), Expect = 1e-29 Identities = 65/84 (77%), Positives = 72/84 (85%) Frame = -2 Query: 252 KKMNKFALRPEKNWRERVNFLTDRILGLKPEESVTDVLEERRVQMLTPTDFCFVVKSVGQ 73 KKM K AL+ K+WR+RV FLTDRILGLK EE V DVL++R+VQM TPTDFCFVVK VGQ Sbjct: 139 KKMTKLALKRAKDWRQRVQFLTDRILGLKSEEFVADVLDDRKVQM-TPTDFCFVVKWVGQ 197 Query: 72 RSWQRALELYECLNLRHWYSPNAR 1 SWQRALE+YE LNLRHWYSPNAR Sbjct: 198 SSWQRALEVYEWLNLRHWYSPNAR 221 >ref|XP_002327945.1| predicted protein [Populus trichocarpa] gi|222837354|gb|EEE75733.1| predicted protein [Populus trichocarpa] Length = 1450 Score = 133 bits (334), Expect = 2e-29 Identities = 63/84 (75%), Positives = 71/84 (84%) Frame = -2 Query: 252 KKMNKFALRPEKNWRERVNFLTDRILGLKPEESVTDVLEERRVQMLTPTDFCFVVKSVGQ 73 KKMNK ALR K+WRERV + TDRILGLK ++ V DVL++R+VQM TPTDFCFVVKSVGQ Sbjct: 141 KKMNKLALRKAKDWRERVKYFTDRILGLKQDQFVADVLDDRKVQM-TPTDFCFVVKSVGQ 199 Query: 72 RSWQRALELYECLNLRHWYSPNAR 1 SW RA E+YE LNLRHWYSPNAR Sbjct: 200 ESWHRAFEVYEWLNLRHWYSPNAR 223 >ref|XP_002519997.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223540761|gb|EEF42321.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 1429 Score = 132 bits (331), Expect = 4e-29 Identities = 62/84 (73%), Positives = 73/84 (86%) Frame = -2 Query: 252 KKMNKFALRPEKNWRERVNFLTDRILGLKPEESVTDVLEERRVQMLTPTDFCFVVKSVGQ 73 KKMNK AL+ K+WRERV FLTDRILGL+P++ V DVL++ +VQM TPTDFCFVVK VGQ Sbjct: 95 KKMNKLALKRAKDWRERVKFLTDRILGLRPDQFVADVLDDSKVQM-TPTDFCFVVKWVGQ 153 Query: 72 RSWQRALELYECLNLRHWYSPNAR 1 +WQRALE++E LNLRHWYSPNAR Sbjct: 154 ENWQRALEVFEWLNLRHWYSPNAR 177