BLASTX nr result
ID: Glycyrrhiza24_contig00032405
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00032405 (284 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003531583.1| PREDICTED: elongation of fatty acids protein... 72 6e-11 ref|XP_003626313.1| Elongation of fatty acids protein [Medicago ... 71 8e-11 ref|XP_004158640.1| PREDICTED: putative elongation of fatty acid... 64 1e-08 ref|XP_004140230.1| PREDICTED: putative elongation of fatty acid... 63 2e-08 ref|XP_002303158.1| predicted protein [Populus trichocarpa] gi|2... 63 2e-08 >ref|XP_003531583.1| PREDICTED: elongation of fatty acids protein A-like [Glycine max] Length = 263 Score = 71.6 bits (174), Expect = 6e-11 Identities = 39/93 (41%), Positives = 47/93 (50%) Frame = +3 Query: 6 IQYWLVYHPRIVNFSWNPPHTLASSQLFLSLAILTYLSLTFLISQSHXXXXXXXXXXXXX 185 +++WLVYHP I FSW PPHT SS LFLSL+IL+YLSLT L++ Sbjct: 4 LEWWLVYHPSIQKFSWKPPHTPFSSPLFLSLSILSYLSLTLLLTL--LPLPPFPHRLLKP 61 Query: 186 IXXXXXXXXXXXXXXXXXXXXXTMLAHTPHLRW 284 I T+L HTPHLRW Sbjct: 62 ITALHNLLLLLLSLLMLLGCSLTLLIHTPHLRW 94 >ref|XP_003626313.1| Elongation of fatty acids protein [Medicago truncatula] gi|124359716|gb|ABD32385.2| GNS1/SUR4 membrane protein [Medicago truncatula] gi|355501328|gb|AES82531.1| Elongation of fatty acids protein [Medicago truncatula] gi|388509788|gb|AFK42960.1| unknown [Medicago truncatula] Length = 274 Score = 71.2 bits (173), Expect = 8e-11 Identities = 30/43 (69%), Positives = 38/43 (88%) Frame = +3 Query: 6 IQYWLVYHPRIVNFSWNPPHTLASSQLFLSLAILTYLSLTFLI 134 +++WLVYHP I+NF+WNPPHT ASS LFLSL+I +YLSLT L+ Sbjct: 9 LEHWLVYHPNILNFTWNPPHTPASSLLFLSLSIASYLSLTLLL 51 >ref|XP_004158640.1| PREDICTED: putative elongation of fatty acids protein DDB_G0272012-like [Cucumis sativus] Length = 273 Score = 64.3 bits (155), Expect = 1e-08 Identities = 27/45 (60%), Positives = 36/45 (80%) Frame = +3 Query: 3 GIQYWLVYHPRIVNFSWNPPHTLASSQLFLSLAILTYLSLTFLIS 137 G+ YWLV HP+I+NFSW+ TL SS LFL++ ++ YLSLTFL+S Sbjct: 8 GLYYWLVNHPKILNFSWSQGETLGSSPLFLTVTVIAYLSLTFLLS 52 >ref|XP_004140230.1| PREDICTED: putative elongation of fatty acids protein DDB_G0272012-like [Cucumis sativus] Length = 273 Score = 63.2 bits (152), Expect = 2e-08 Identities = 26/45 (57%), Positives = 36/45 (80%) Frame = +3 Query: 3 GIQYWLVYHPRIVNFSWNPPHTLASSQLFLSLAILTYLSLTFLIS 137 G+ YWL+ HP+I+NFSW+ TL SS LFL++ ++ YLSLTFL+S Sbjct: 8 GLYYWLLNHPKILNFSWSQGETLGSSPLFLTVTVIAYLSLTFLLS 52 >ref|XP_002303158.1| predicted protein [Populus trichocarpa] gi|222840590|gb|EEE78137.1| predicted protein [Populus trichocarpa] Length = 272 Score = 63.2 bits (152), Expect = 2e-08 Identities = 27/44 (61%), Positives = 36/44 (81%) Frame = +3 Query: 6 IQYWLVYHPRIVNFSWNPPHTLASSQLFLSLAILTYLSLTFLIS 137 +QYWLV +P I+NFSWN TL +S LFL+L +L+YLSLTF++S Sbjct: 13 LQYWLVNNPHILNFSWNQGQTLGASPLFLTLTVLSYLSLTFILS 56