BLASTX nr result
ID: Glycyrrhiza24_contig00032252
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00032252 (344 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003535076.1| PREDICTED: G-type lectin S-receptor-like ser... 73 3e-11 ref|XP_003526143.1| PREDICTED: G-type lectin S-receptor-like ser... 72 6e-11 ref|XP_003533891.1| PREDICTED: G-type lectin S-receptor-like ser... 71 1e-10 ref|XP_003526137.1| PREDICTED: G-type lectin S-receptor-like ser... 70 2e-10 ref|XP_003541080.1| PREDICTED: G-type lectin S-receptor-like ser... 70 2e-10 >ref|XP_003535076.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein kinase At4g27290-like [Glycine max] Length = 859 Score = 72.8 bits (177), Expect = 3e-11 Identities = 34/51 (66%), Positives = 41/51 (80%) Frame = +2 Query: 191 ISSSTDTLNGSQSLSDDGSTLVSKDGTFEMGFFSPGNNNPNHYLGIWYKKI 343 I +TDT+ Q LSDDGSTLVS GTFE+GFF+PG++N N Y+GIWYKKI Sbjct: 58 ICYATDTITQDQQLSDDGSTLVSNGGTFELGFFNPGSSN-NRYVGIWYKKI 107 >ref|XP_003526143.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein kinase At4g27290-like [Glycine max] Length = 778 Score = 71.6 bits (174), Expect = 6e-11 Identities = 35/51 (68%), Positives = 43/51 (84%) Frame = +2 Query: 191 ISSSTDTLNGSQSLSDDGSTLVSKDGTFEMGFFSPGNNNPNHYLGIWYKKI 343 IS +TDT+ SQ L D GSTLVSK+GTFE+GFF+PG N+PNHY+GIW+K I Sbjct: 20 ISYATDTITQSQPLLD-GSTLVSKEGTFELGFFTPG-NSPNHYVGIWFKNI 68 >ref|XP_003533891.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein kinase At4g27290-like [Glycine max] Length = 783 Score = 70.9 bits (172), Expect = 1e-10 Identities = 31/49 (63%), Positives = 41/49 (83%) Frame = +2 Query: 197 SSTDTLNGSQSLSDDGSTLVSKDGTFEMGFFSPGNNNPNHYLGIWYKKI 343 ++TDT+ Q L DDG+TL+SKDGTFE+GFF+PG++N N Y+GIWYK I Sbjct: 23 ATTDTITKGQPLPDDGNTLLSKDGTFELGFFNPGSSN-NRYVGIWYKNI 70 >ref|XP_003526137.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein kinase At4g27290-like [Glycine max] Length = 821 Score = 70.1 bits (170), Expect = 2e-10 Identities = 32/54 (59%), Positives = 42/54 (77%) Frame = +2 Query: 182 SPSISSSTDTLNGSQSLSDDGSTLVSKDGTFEMGFFSPGNNNPNHYLGIWYKKI 343 S + ++TD +N QSL +D +TLVS DGTFE+GFF+PG+ +PN YLGIWYK I Sbjct: 17 SSNFLAATDMINQFQSL-EDNTTLVSNDGTFELGFFTPGSTSPNRYLGIWYKNI 69 >ref|XP_003541080.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein kinase At4g27290-like [Glycine max] Length = 824 Score = 69.7 bits (169), Expect = 2e-10 Identities = 31/50 (62%), Positives = 41/50 (82%) Frame = +2 Query: 194 SSSTDTLNGSQSLSDDGSTLVSKDGTFEMGFFSPGNNNPNHYLGIWYKKI 343 +++TDT+N +SL +D +TLVS DGTFE+GFF PG+ +PN YLGIWYK I Sbjct: 21 AAATDTINQFESL-EDNTTLVSNDGTFELGFFIPGSTSPNRYLGIWYKNI 69