BLASTX nr result
ID: Glycyrrhiza24_contig00032235
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00032235 (442 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003555650.1| PREDICTED: uncharacterized protein LOC100817... 57 2e-06 ref|XP_003600524.1| hypothetical protein MTR_3g062210 [Medicago ... 56 3e-06 >ref|XP_003555650.1| PREDICTED: uncharacterized protein LOC100817175 [Glycine max] Length = 2045 Score = 57.0 bits (136), Expect = 2e-06 Identities = 24/46 (52%), Positives = 31/46 (67%), Gaps = 1/46 (2%) Frame = -3 Query: 329 KQCTFCNKLGHTVDECYTKHDFPPGYRP-RNPSTINNLSLPDSDHT 195 K CT C K+GHTVD CY KH +PPGY+P +T+NN+ +S T Sbjct: 628 KACTHCGKIGHTVDVCYRKHGYPPGYKPYSGRTTVNNVVAVESKAT 673 >ref|XP_003600524.1| hypothetical protein MTR_3g062210 [Medicago truncatula] gi|355489572|gb|AES70775.1| hypothetical protein MTR_3g062210 [Medicago truncatula] Length = 405 Score = 55.8 bits (133), Expect = 3e-06 Identities = 29/63 (46%), Positives = 36/63 (57%) Frame = -3 Query: 332 SKQCTFCNKLGHTVDECYTKHDFPPGYRPRNPSTINNLSLPDSDHTHTELASVSSQGSNS 153 SK CTFC + GHTVD CY KH FPP + +N S N SL D+ H + S S+S Sbjct: 167 SKLCTFCGRHGHTVDTCYKKHGFPPNF-GQNSSVNNVESLLDNVHVAENVEEPSKVQSSS 225 Query: 152 QPI 144 P+ Sbjct: 226 GPM 228