BLASTX nr result
ID: Glycyrrhiza24_contig00032217
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00032217 (297 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003556166.1| PREDICTED: carboxypeptidase D-like [Glycine ... 65 6e-09 ref|XP_003535561.1| PREDICTED: carboxypeptidase D-like [Glycine ... 57 2e-06 >ref|XP_003556166.1| PREDICTED: carboxypeptidase D-like [Glycine max] Length = 502 Score = 65.1 bits (157), Expect = 6e-09 Identities = 35/46 (76%), Positives = 42/46 (91%), Gaps = 1/46 (2%) Frame = -3 Query: 139 KGALQ-SLAPSDFNNYSNASRARHLLEDNESQAQRSVDLAQGYMTN 5 KG+LQ +L PS+FN+ SNAS+ARHLLED ESQAQ+SVDLAQGYM+N Sbjct: 33 KGSLQQTLLPSEFNDCSNASQARHLLED-ESQAQKSVDLAQGYMSN 77 >ref|XP_003535561.1| PREDICTED: carboxypeptidase D-like [Glycine max] Length = 496 Score = 56.6 bits (135), Expect = 2e-06 Identities = 34/47 (72%), Positives = 40/47 (85%), Gaps = 2/47 (4%) Frame = -3 Query: 139 KGALQ-SLAPSD-FNNYSNASRARHLLEDNESQAQRSVDLAQGYMTN 5 KG+LQ +L PS+ FN+ SNAS ARHLLED ESQAQ SVDLAQG+M+N Sbjct: 26 KGSLQQTLLPSEEFNDGSNASSARHLLED-ESQAQTSVDLAQGFMSN 71