BLASTX nr result
ID: Glycyrrhiza24_contig00032204
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00032204 (290 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAC35532.1| contains similarity to proteases [Arabidopsis tha... 56 3e-06 dbj|BAD44345.1| retrotransposon like protein [Arabidopsis thaliana] 56 3e-06 dbj|BAF00669.1| retrotransposon like protein [Arabidopsis thaliana] 56 3e-06 emb|CAB40035.1| retrotransposon like protein [Arabidopsis thalia... 56 3e-06 >gb|AAC35532.1| contains similarity to proteases [Arabidopsis thaliana] Length = 1392 Score = 56.2 bits (134), Expect = 3e-06 Identities = 22/35 (62%), Positives = 27/35 (77%) Frame = -2 Query: 289 GNGTKPTCQICYKYGHAAFDCWNRFNEDYVQPPPP 185 GNG+KPTCQIC KYGH+AF C+ RF E+Y+ P Sbjct: 274 GNGSKPTCQICRKYGHSAFKCYTRFEENYLPEDLP 308 >dbj|BAD44345.1| retrotransposon like protein [Arabidopsis thaliana] Length = 383 Score = 56.2 bits (134), Expect = 3e-06 Identities = 22/35 (62%), Positives = 27/35 (77%) Frame = -2 Query: 289 GNGTKPTCQICYKYGHAAFDCWNRFNEDYVQPPPP 185 GNG+KPTCQIC KYGH+AF C+ RF E+Y+ P Sbjct: 274 GNGSKPTCQICRKYGHSAFKCYTRFEENYLPEDLP 308 >dbj|BAF00669.1| retrotransposon like protein [Arabidopsis thaliana] Length = 392 Score = 56.2 bits (134), Expect = 3e-06 Identities = 22/35 (62%), Positives = 27/35 (77%) Frame = -2 Query: 289 GNGTKPTCQICYKYGHAAFDCWNRFNEDYVQPPPP 185 GNG+KPTCQIC KYGH+AF C+ RF E+Y+ P Sbjct: 274 GNGSKPTCQICRKYGHSAFKCYTRFEENYLPEDLP 308 >emb|CAB40035.1| retrotransposon like protein [Arabidopsis thaliana] gi|7267767|emb|CAB81170.1| retrotransposon like protein [Arabidopsis thaliana] Length = 1515 Score = 56.2 bits (134), Expect = 3e-06 Identities = 22/35 (62%), Positives = 27/35 (77%) Frame = -2 Query: 289 GNGTKPTCQICYKYGHAAFDCWNRFNEDYVQPPPP 185 GNG+KPTCQIC KYGH+AF C+ RF E+Y+ P Sbjct: 271 GNGSKPTCQICRKYGHSAFKCYTRFEENYLPEDLP 305