BLASTX nr result
ID: Glycyrrhiza24_contig00032197
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00032197 (414 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003618001.1| hypothetical protein MTR_5g097880 [Medicago ... 106 2e-21 ref|XP_003637612.1| hypothetical protein MTR_092s0002 [Medicago ... 93 3e-17 >ref|XP_003618001.1| hypothetical protein MTR_5g097880 [Medicago truncatula] gi|355519336|gb|AET00960.1| hypothetical protein MTR_5g097880 [Medicago truncatula] Length = 120 Score = 106 bits (264), Expect = 2e-21 Identities = 46/85 (54%), Positives = 64/85 (75%) Frame = +3 Query: 3 NKIFERCDRVTKPDQSPKFMAKCMKEIGSDCGEEVANKLMHDKNISEKCCTKFVKMSRKC 182 ++IF +CD VT+P+ +PKF AKC+ E+ S CGEE+ N ++++ NIS+KCC K VKM +C Sbjct: 25 DEIFHKCDLVTRPE-NPKFFAKCINELDSHCGEEIFNSIVNENNISKKCCGKLVKMGEEC 83 Query: 183 HINMTKALIRTPKMKNVDVTPVLVK 257 H NM KALIRTP+M+N+D L K Sbjct: 84 HTNMAKALIRTPEMRNIDAIEFLKK 108 >ref|XP_003637612.1| hypothetical protein MTR_092s0002 [Medicago truncatula] gi|355503547|gb|AES84750.1| hypothetical protein MTR_092s0002 [Medicago truncatula] Length = 146 Score = 92.8 bits (229), Expect = 3e-17 Identities = 39/76 (51%), Positives = 57/76 (75%) Frame = +3 Query: 9 IFERCDRVTKPDQSPKFMAKCMKEIGSDCGEEVANKLMHDKNISEKCCTKFVKMSRKCHI 188 IF +CD T+PD + KF++ C+++IGS CGEEV N ++++ + ++KCC K V M +CH Sbjct: 54 IFNKCDLATRPDDT-KFLSACIEKIGSRCGEEVLNSIVNNTSTTKKCCDKLVNMGERCHT 112 Query: 189 NMTKALIRTPKMKNVD 236 NM K LIRTP+MKN+D Sbjct: 113 NMAKILIRTPEMKNMD 128