BLASTX nr result
ID: Glycyrrhiza24_contig00031466
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00031466 (323 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003523763.1| PREDICTED: multidrug and toxin extrusion pro... 84 2e-14 ref|XP_003527862.1| PREDICTED: multidrug and toxin extrusion pro... 80 2e-13 ref|XP_003615399.1| Multidrug and toxin extrusion protein [Medic... 59 4e-07 >ref|XP_003523763.1| PREDICTED: multidrug and toxin extrusion protein 1-like [Glycine max] Length = 537 Score = 83.6 bits (205), Expect = 2e-14 Identities = 41/58 (70%), Positives = 44/58 (75%), Gaps = 6/58 (10%) Frame = +1 Query: 166 MCNPKP-----FLCPTKTHLITPDPKVTNCPPD-DPVQQDELQRWPTPNEVIAEMKAI 321 MCNPKP FLCPTK H+ITPDPK+ N PP D +DEL RWPTPNEVIAEMKAI Sbjct: 1 MCNPKPSSSSPFLCPTKNHIITPDPKLINHPPPVDDQLKDELHRWPTPNEVIAEMKAI 58 >ref|XP_003527862.1| PREDICTED: multidrug and toxin extrusion protein 1-like [Glycine max] Length = 548 Score = 79.7 bits (195), Expect = 2e-13 Identities = 40/59 (67%), Positives = 44/59 (74%), Gaps = 7/59 (11%) Frame = +1 Query: 166 MCNPKP-----FLCPTKTHLI-TPDPKVTNCPPD-DPVQQDELQRWPTPNEVIAEMKAI 321 MCNPKP FLCPTK H+I TPDPK+ N PP D QDEL RWPTPNE++AEMKAI Sbjct: 1 MCNPKPSSSSPFLCPTKNHIISTPDPKLINHPPPVDDQLQDELHRWPTPNEIVAEMKAI 59 >ref|XP_003615399.1| Multidrug and toxin extrusion protein [Medicago truncatula] gi|355516734|gb|AES98357.1| Multidrug and toxin extrusion protein [Medicago truncatula] Length = 560 Score = 58.9 bits (141), Expect = 4e-07 Identities = 33/60 (55%), Positives = 35/60 (58%), Gaps = 8/60 (13%) Frame = +1 Query: 166 MCNPKP------FLCPTKTHLITPDPK--VTNCPPDDPVQQDELQRWPTPNEVIAEMKAI 321 MCNPKP FL PTKTHLI P K +N DD QDEL RWPT E I E+K I Sbjct: 1 MCNPKPSSPTSPFLSPTKTHLINPHTKDPYSNSTLDDDHVQDELHRWPTLKEAITEIKEI 60