BLASTX nr result
ID: Glycyrrhiza24_contig00031329
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00031329 (221 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAP03085.1| class IV chitinase [Galega orientalis] 65 8e-09 ref|XP_003597546.1| Chitinase [Medicago truncatula] gi|355486594... 59 3e-07 ref|XP_003597548.1| Endochitinase PR4 [Medicago truncatula] gi|3... 57 2e-06 gb|ACL36992.1| class IV chitinase [Medicago sativa] 57 2e-06 gb|AFK40619.1| unknown [Medicago truncatula] 57 2e-06 >gb|AAP03085.1| class IV chitinase [Galega orientalis] Length = 275 Score = 64.7 bits (156), Expect = 8e-09 Identities = 28/47 (59%), Positives = 36/47 (76%) Frame = +1 Query: 79 IMGNKFQSIGIIGVASTLMLVILVPIKSASGQNCGCEEGLCCSQYGY 219 +MGNK QSI I+G A +++I+VPI + S QNCGC G+CCSQYGY Sbjct: 3 MMGNKLQSISIVGFAIAFLIMIIVPI-NVSAQNCGCAAGVCCSQYGY 48 >ref|XP_003597546.1| Chitinase [Medicago truncatula] gi|355486594|gb|AES67797.1| Chitinase [Medicago truncatula] Length = 175 Score = 59.3 bits (142), Expect = 3e-07 Identities = 27/47 (57%), Positives = 35/47 (74%) Frame = +1 Query: 79 IMGNKFQSIGIIGVASTLMLVILVPIKSASGQNCGCEEGLCCSQYGY 219 ++GNK S+ I +A ++I+VP KS S QNCGCEEGLCCSQ+GY Sbjct: 3 MIGNKSLSMSIAKLAIAFFIMIMVP-KSISAQNCGCEEGLCCSQFGY 48 >ref|XP_003597548.1| Endochitinase PR4 [Medicago truncatula] gi|355486596|gb|AES67799.1| Endochitinase PR4 [Medicago truncatula] Length = 553 Score = 57.0 bits (136), Expect = 2e-06 Identities = 26/47 (55%), Positives = 34/47 (72%) Frame = +1 Query: 79 IMGNKFQSIGIIGVASTLMLVILVPIKSASGQNCGCEEGLCCSQYGY 219 +MGNK SI + +A ++I+VP K+ S QNCGC EG+CCSQYGY Sbjct: 3 MMGNKSLSICMATLAIAFFIMIMVP-KNVSAQNCGCAEGVCCSQYGY 48 >gb|ACL36992.1| class IV chitinase [Medicago sativa] Length = 282 Score = 57.0 bits (136), Expect = 2e-06 Identities = 26/47 (55%), Positives = 34/47 (72%) Frame = +1 Query: 79 IMGNKFQSIGIIGVASTLMLVILVPIKSASGQNCGCEEGLCCSQYGY 219 +MGNK SI + +A ++I+VP K+ S QNCGC EG+CCSQYGY Sbjct: 3 MMGNKSLSICMATLAIAFFIMIMVP-KNVSAQNCGCAEGVCCSQYGY 48 >gb|AFK40619.1| unknown [Medicago truncatula] Length = 282 Score = 57.0 bits (136), Expect = 2e-06 Identities = 26/47 (55%), Positives = 34/47 (72%) Frame = +1 Query: 79 IMGNKFQSIGIIGVASTLMLVILVPIKSASGQNCGCEEGLCCSQYGY 219 +MGNK SI + +A ++I+VP K+ S QNCGC EG+CCSQYGY Sbjct: 3 MMGNKSLSICMATLAIAFFIMIMVP-KNVSAQNCGCAEGVCCSQYGY 48