BLASTX nr result
ID: Glycyrrhiza24_contig00031158
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00031158 (381 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003527761.1| PREDICTED: pentatricopeptide repeat-containi... 177 8e-43 ref|XP_003603234.1| Pentatricopeptide repeat-containing protein ... 176 2e-42 ref|XP_003523656.1| PREDICTED: pentatricopeptide repeat-containi... 175 4e-42 ref|XP_002867196.1| pentatricopeptide repeat-containing protein ... 175 4e-42 ref|NP_195043.1| pentatricopeptide repeat-containing protein [Ar... 174 9e-42 >ref|XP_003527761.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33170-like [Glycine max] Length = 1582 Score = 177 bits (449), Expect = 8e-43 Identities = 79/92 (85%), Positives = 87/92 (94%) Frame = +1 Query: 1 YVPDTDFTLVDIEEEDKESALYHHSEKLAIAYGLIKTPPSTPIRVIKNLRVCGDCHNAIK 180 Y+PDTDF LVD+EEEDKE +LY+HSEKLAIAYGL+KTPPST +RVIKNLRVCGDCHNAIK Sbjct: 1491 YLPDTDFALVDVEEEDKECSLYYHSEKLAIAYGLMKTPPSTTLRVIKNLRVCGDCHNAIK 1550 Query: 181 YISKVFQREIVLRDANRFHRFRSGTCSCGDYW 276 YISKVF+RE+VLRDANRFH FRSG CSCGDYW Sbjct: 1551 YISKVFEREVVLRDANRFHHFRSGVCSCGDYW 1582 >ref|XP_003603234.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355492282|gb|AES73485.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 973 Score = 176 bits (446), Expect = 2e-42 Identities = 82/92 (89%), Positives = 86/92 (93%) Frame = +1 Query: 1 YVPDTDFTLVDIEEEDKESALYHHSEKLAIAYGLIKTPPSTPIRVIKNLRVCGDCHNAIK 180 YVPDT+F LVDIEEEDKESAL +HSEKLAIAYGL+KTPPST +RVIKNLRVCGDCHNAIK Sbjct: 882 YVPDTEFALVDIEEEDKESALSYHSEKLAIAYGLMKTPPSTTLRVIKNLRVCGDCHNAIK 941 Query: 181 YISKVFQREIVLRDANRFHRFRSGTCSCGDYW 276 YIS VFQREIVLRDANRFH FRSG CSCGDYW Sbjct: 942 YISNVFQREIVLRDANRFHHFRSGICSCGDYW 973 >ref|XP_003523656.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33170-like [Glycine max] Length = 1611 Score = 175 bits (443), Expect = 4e-42 Identities = 79/92 (85%), Positives = 87/92 (94%) Frame = +1 Query: 1 YVPDTDFTLVDIEEEDKESALYHHSEKLAIAYGLIKTPPSTPIRVIKNLRVCGDCHNAIK 180 YVPDTDF LVD+EEEDKE +LY+HSEKLAIAYGL+KTPPST +RVIKNLRVCGDCH+AIK Sbjct: 1520 YVPDTDFALVDVEEEDKECSLYYHSEKLAIAYGLMKTPPSTTLRVIKNLRVCGDCHSAIK 1579 Query: 181 YISKVFQREIVLRDANRFHRFRSGTCSCGDYW 276 YISKVF+REIVLRDANRFH FR+G CSCGDYW Sbjct: 1580 YISKVFKREIVLRDANRFHHFRNGICSCGDYW 1611 >ref|XP_002867196.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297313032|gb|EFH43455.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 997 Score = 175 bits (443), Expect = 4e-42 Identities = 77/92 (83%), Positives = 87/92 (94%) Frame = +1 Query: 1 YVPDTDFTLVDIEEEDKESALYHHSEKLAIAYGLIKTPPSTPIRVIKNLRVCGDCHNAIK 180 YVP+TDFTLVD+EEE+KE ALY+HSEKLA+A+GL+ TPPSTPIRVIKNLRVCGDCHNA+K Sbjct: 906 YVPETDFTLVDVEEEEKERALYYHSEKLAVAFGLLSTPPSTPIRVIKNLRVCGDCHNAMK 965 Query: 181 YISKVFQREIVLRDANRFHRFRSGTCSCGDYW 276 YISKV+ REIVLRDANRFHRF+ G CSCGDYW Sbjct: 966 YISKVYDREIVLRDANRFHRFKDGICSCGDYW 997 >ref|NP_195043.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75206840|sp|Q9SMZ2.1|PP347_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At4g33170 gi|4455331|emb|CAB36791.1| putative protein [Arabidopsis thaliana] gi|7270265|emb|CAB80034.1| putative protein [Arabidopsis thaliana] gi|332660786|gb|AEE86186.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 990 Score = 174 bits (440), Expect = 9e-42 Identities = 76/92 (82%), Positives = 87/92 (94%) Frame = +1 Query: 1 YVPDTDFTLVDIEEEDKESALYHHSEKLAIAYGLIKTPPSTPIRVIKNLRVCGDCHNAIK 180 YVP+TDFTLVD+EEE+KE ALY+HSEKLA+A+GL+ TPPSTPIRVIKNLRVCGDCHNA+K Sbjct: 899 YVPETDFTLVDVEEEEKERALYYHSEKLAVAFGLLSTPPSTPIRVIKNLRVCGDCHNAMK 958 Query: 181 YISKVFQREIVLRDANRFHRFRSGTCSCGDYW 276 YI+KV+ REIVLRDANRFHRF+ G CSCGDYW Sbjct: 959 YIAKVYNREIVLRDANRFHRFKDGICSCGDYW 990