BLASTX nr result
ID: Glycyrrhiza24_contig00031103
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00031103 (275 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003619828.1| Pentatricopeptide repeat-containing protein ... 149 2e-34 emb|CBI18867.3| unnamed protein product [Vitis vinifera] 119 3e-25 gb|AAF17637.1|AC009978_13 T23E18.21 [Arabidopsis thaliana] 112 4e-23 gb|AAF16672.1|AC012394_21 hypothetical protein; 84465-87513 [Ara... 112 4e-23 ref|NP_001185409.1| pentatricopeptide repeat-containing protein ... 112 4e-23 >ref|XP_003619828.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355494843|gb|AES76046.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 895 Score = 149 bits (377), Expect = 2e-34 Identities = 75/91 (82%), Positives = 84/91 (92%) Frame = -1 Query: 275 LAWKLILQMQNLGLQPSSHTYDCIIRAVVSQRSFGDAMGVLQKMQQENLKPYDSTLATLS 96 LAWKLILQMQ+LGLQPSSHTY+ +IRA+VSQR FGDAM +L+KMQQENLK DSTLATLS Sbjct: 379 LAWKLILQMQSLGLQPSSHTYNGLIRAIVSQRRFGDAMRMLKKMQQENLKLVDSTLATLS 438 Query: 95 VTCSKKLQLDLAESLLNQISECLHPHPYNAL 3 V S++LQLDLAESLLNQISECL+PHPYNAL Sbjct: 439 VAFSRELQLDLAESLLNQISECLYPHPYNAL 469 >emb|CBI18867.3| unnamed protein product [Vitis vinifera] Length = 804 Score = 119 bits (298), Expect = 3e-25 Identities = 61/90 (67%), Positives = 71/90 (78%) Frame = -1 Query: 275 LAWKLILQMQNLGLQPSSHTYDCIIRAVVSQRSFGDAMGVLQKMQQENLKPYDSTLATLS 96 LA +LILQMQNLGL+PS HTYD +I+A+VS R F D M VL+ MQ NLKPYDSTLA LS Sbjct: 346 LAEQLILQMQNLGLEPSCHTYDGLIKAIVSDRGFSDGMEVLKTMQLRNLKPYDSTLAALS 405 Query: 95 VTCSKKLQLDLAESLLNQISECLHPHPYNA 6 + SK LQLDLAESLL+QIS + HP+NA Sbjct: 406 IGSSKALQLDLAESLLDQISRISYVHPFNA 435 >gb|AAF17637.1|AC009978_13 T23E18.21 [Arabidopsis thaliana] Length = 800 Score = 112 bits (279), Expect = 4e-23 Identities = 57/91 (62%), Positives = 70/91 (76%) Frame = -1 Query: 275 LAWKLILQMQNLGLQPSSHTYDCIIRAVVSQRSFGDAMGVLQKMQQENLKPYDSTLATLS 96 LA +L+LQMQNLGL PSSHTYD IRAV + M +L+ MQQ+NLKPYDSTLAT++ Sbjct: 303 LAEQLMLQMQNLGLLPSSHTYDGFIRAVAFPEGYEYGMTLLKVMQQQNLKPYDSTLATVA 362 Query: 95 VTCSKKLQLDLAESLLNQISECLHPHPYNAL 3 CSK LQ+DLAE LL+QISEC + +P+N L Sbjct: 363 AYCSKALQVDLAEHLLDQISECSYSYPFNNL 393 >gb|AAF16672.1|AC012394_21 hypothetical protein; 84465-87513 [Arabidopsis thaliana] Length = 558 Score = 112 bits (279), Expect = 4e-23 Identities = 57/91 (62%), Positives = 70/91 (76%) Frame = -1 Query: 275 LAWKLILQMQNLGLQPSSHTYDCIIRAVVSQRSFGDAMGVLQKMQQENLKPYDSTLATLS 96 LA +L+LQMQNLGL PSSHTYD IRAV + M +L+ MQQ+NLKPYDSTLAT++ Sbjct: 90 LAEQLMLQMQNLGLLPSSHTYDGFIRAVAFPEGYEYGMTLLKVMQQQNLKPYDSTLATVA 149 Query: 95 VTCSKKLQLDLAESLLNQISECLHPHPYNAL 3 CSK LQ+DLAE LL+QISEC + +P+N L Sbjct: 150 AYCSKALQVDLAEHLLDQISECSYSYPFNNL 180 >ref|NP_001185409.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|332197699|gb|AEE35820.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 801 Score = 112 bits (279), Expect = 4e-23 Identities = 57/91 (62%), Positives = 70/91 (76%) Frame = -1 Query: 275 LAWKLILQMQNLGLQPSSHTYDCIIRAVVSQRSFGDAMGVLQKMQQENLKPYDSTLATLS 96 LA +L+LQMQNLGL PSSHTYD IRAV + M +L+ MQQ+NLKPYDSTLAT++ Sbjct: 347 LAEQLMLQMQNLGLLPSSHTYDGFIRAVAFPEGYEYGMTLLKVMQQQNLKPYDSTLATVA 406 Query: 95 VTCSKKLQLDLAESLLNQISECLHPHPYNAL 3 CSK LQ+DLAE LL+QISEC + +P+N L Sbjct: 407 AYCSKALQVDLAEHLLDQISECSYSYPFNNL 437