BLASTX nr result
ID: Glycyrrhiza24_contig00031095
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00031095 (259 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_084835.1| ribosomal protein S3 [Lotus japonicus] gi|27734... 80 1e-13 ref|YP_538803.1| ribosomal protein S3 [Glycine max] gi|91207777|... 78 7e-13 ref|YP_005088845.1| ribosomal protein S3 (chloroplast) [Milletti... 78 7e-13 ref|NP_001235926.1| uncharacterized protein LOC100526915 [Glycin... 78 7e-13 ref|YP_002149770.1| ribosomal protein S3 [Cicer arietinum] gi|19... 76 3e-12 >ref|NP_084835.1| ribosomal protein S3 [Lotus japonicus] gi|27734485|sp|Q9BBP8.1|RR3_LOTJA RecName: Full=30S ribosomal protein S3, chloroplastic gi|13359017|dbj|BAB33234.1| ribosomal protein S3 [Lotus japonicus] Length = 218 Score = 80.5 bits (197), Expect = 1e-13 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = -1 Query: 112 MGQKINPLGFRLGTTQSHDSIWFAQPTNYSKNLKEDK 2 MGQKINPLGFRLGTTQSHDSIWFAQPTNYS+NLKEDK Sbjct: 1 MGQKINPLGFRLGTTQSHDSIWFAQPTNYSENLKEDK 37 >ref|YP_538803.1| ribosomal protein S3 [Glycine max] gi|91207777|sp|Q2PMP7.1|RR3_SOYBN RecName: Full=30S ribosomal protein S3, chloroplastic gi|83595780|gb|ABC25161.1| ribosomal protein S3 [Glycine max] Length = 216 Score = 78.2 bits (191), Expect = 7e-13 Identities = 34/37 (91%), Positives = 37/37 (100%) Frame = -1 Query: 112 MGQKINPLGFRLGTTQSHDSIWFAQPTNYSKNLKEDK 2 MGQKINPLGFRLGTTQSHDSIWFAQPTNYS+N++EDK Sbjct: 1 MGQKINPLGFRLGTTQSHDSIWFAQPTNYSENIQEDK 37 >ref|YP_005088845.1| ribosomal protein S3 (chloroplast) [Millettia pinnata] gi|356474864|gb|AET11382.1| ribosomal protein S3 (chloroplast) [Millettia pinnata] Length = 218 Score = 78.2 bits (191), Expect = 7e-13 Identities = 34/37 (91%), Positives = 37/37 (100%) Frame = -1 Query: 112 MGQKINPLGFRLGTTQSHDSIWFAQPTNYSKNLKEDK 2 MGQKINPLGFRLGTTQSHDS+WFAQPTNYS+NL+EDK Sbjct: 1 MGQKINPLGFRLGTTQSHDSLWFAQPTNYSENLQEDK 37 >ref|NP_001235926.1| uncharacterized protein LOC100526915 [Glycine max] gi|255631141|gb|ACU15936.1| unknown [Glycine max] Length = 206 Score = 78.2 bits (191), Expect = 7e-13 Identities = 34/37 (91%), Positives = 37/37 (100%) Frame = -1 Query: 112 MGQKINPLGFRLGTTQSHDSIWFAQPTNYSKNLKEDK 2 MGQKINPLGFRLGTTQSHDSIWFAQPTNYS+N++EDK Sbjct: 1 MGQKINPLGFRLGTTQSHDSIWFAQPTNYSENIQEDK 37 >ref|YP_002149770.1| ribosomal protein S3 [Cicer arietinum] gi|197089837|gb|ACH41107.1| ribosomal protein S3 [Cicer arietinum] Length = 218 Score = 76.3 bits (186), Expect = 3e-12 Identities = 34/37 (91%), Positives = 36/37 (97%) Frame = -1 Query: 112 MGQKINPLGFRLGTTQSHDSIWFAQPTNYSKNLKEDK 2 MGQKI+PLGFRLGTTQSHDSIWFAQP NYS+NLKEDK Sbjct: 1 MGQKIHPLGFRLGTTQSHDSIWFAQPRNYSENLKEDK 37