BLASTX nr result
ID: Glycyrrhiza24_contig00031046
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00031046 (268 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003522508.1| PREDICTED: mini-chromosome maintenance compl... 80 2e-13 ref|XP_002520848.1| conserved hypothetical protein [Ricinus comm... 80 2e-13 ref|XP_003526806.1| PREDICTED: mini-chromosome maintenance compl... 79 3e-13 ref|XP_004164464.1| PREDICTED: mini-chromosome maintenance compl... 75 6e-12 ref|XP_004138398.1| PREDICTED: mini-chromosome maintenance compl... 75 6e-12 >ref|XP_003522508.1| PREDICTED: mini-chromosome maintenance complex-binding protein-like [Glycine max] Length = 590 Score = 80.1 bits (196), Expect = 2e-13 Identities = 36/48 (75%), Positives = 41/48 (85%) Frame = +2 Query: 125 MVGPQYDILANPLGAVRSTFENAIASGSDPSSFDGRDWGAIDLFRRFL 268 MVGPQYD LANPLGAVRSTF+ A+AS DPS+FDGRDWG + LF+ FL Sbjct: 1 MVGPQYDFLANPLGAVRSTFDAAVASVPDPSAFDGRDWGVLPLFQHFL 48 >ref|XP_002520848.1| conserved hypothetical protein [Ricinus communis] gi|223539979|gb|EEF41557.1| conserved hypothetical protein [Ricinus communis] Length = 579 Score = 80.1 bits (196), Expect = 2e-13 Identities = 36/48 (75%), Positives = 41/48 (85%) Frame = +2 Query: 125 MVGPQYDILANPLGAVRSTFENAIASGSDPSSFDGRDWGAIDLFRRFL 268 M GP YD +ANPLGAVR TF+ AI+SG+ PSSFDG+DWGAIDLFR FL Sbjct: 1 MGGPPYDCIANPLGAVRLTFDKAISSGTQPSSFDGKDWGAIDLFRHFL 48 >ref|XP_003526806.1| PREDICTED: mini-chromosome maintenance complex-binding protein-like [Glycine max] Length = 589 Score = 79.3 bits (194), Expect = 3e-13 Identities = 36/48 (75%), Positives = 39/48 (81%) Frame = +2 Query: 125 MVGPQYDILANPLGAVRSTFENAIASGSDPSSFDGRDWGAIDLFRRFL 268 MVGPQYD LANPLG VRSTF+ A+AS SDPS+FDGRDWG LF FL Sbjct: 1 MVGPQYDFLANPLGVVRSTFDAAVASVSDPSAFDGRDWGVFPLFHHFL 48 >ref|XP_004164464.1| PREDICTED: mini-chromosome maintenance complex-binding protein-like [Cucumis sativus] Length = 590 Score = 75.1 bits (183), Expect = 6e-12 Identities = 34/48 (70%), Positives = 40/48 (83%) Frame = +2 Query: 125 MVGPQYDILANPLGAVRSTFENAIASGSDPSSFDGRDWGAIDLFRRFL 268 MVG YD L NPLGAVRSTFE AI+SGS+P+SFDG+DWGA+ F+ FL Sbjct: 1 MVGLPYDFLVNPLGAVRSTFEKAISSGSNPASFDGKDWGALQPFQHFL 48 >ref|XP_004138398.1| PREDICTED: mini-chromosome maintenance complex-binding protein-like [Cucumis sativus] Length = 590 Score = 75.1 bits (183), Expect = 6e-12 Identities = 34/48 (70%), Positives = 40/48 (83%) Frame = +2 Query: 125 MVGPQYDILANPLGAVRSTFENAIASGSDPSSFDGRDWGAIDLFRRFL 268 MVG YD L NPLGAVRSTFE AI+SGS+P+SFDG+DWGA+ F+ FL Sbjct: 1 MVGLPYDFLVNPLGAVRSTFEKAISSGSNPASFDGKDWGALQPFQHFL 48