BLASTX nr result
ID: Glycyrrhiza24_contig00030988
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00030988 (307 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003553019.1| PREDICTED: uncharacterized protein LOC100784... 71 8e-11 ref|XP_003600247.1| Kinesin like protein [Medicago truncatula] g... 70 2e-10 >ref|XP_003553019.1| PREDICTED: uncharacterized protein LOC100784708 [Glycine max] Length = 1122 Score = 71.2 bits (173), Expect = 8e-11 Identities = 37/55 (67%), Positives = 41/55 (74%), Gaps = 4/55 (7%) Frame = -2 Query: 153 KTTSSNPK---TDLENTPPT-HPNIPVNHHLHSHPKTPFSHNDPPVKVVVRIRPE 1 K TSSNPK +D ENTPPT HPNIP+N H S P PFSH++ VKVVVRIRPE Sbjct: 31 KPTSSNPKPPKSDTENTPPTTHPNIPINLHHQSKPNDPFSHSNSHVKVVVRIRPE 85 >ref|XP_003600247.1| Kinesin like protein [Medicago truncatula] gi|355489295|gb|AES70498.1| Kinesin like protein [Medicago truncatula] Length = 1115 Score = 70.1 bits (170), Expect = 2e-10 Identities = 32/52 (61%), Positives = 41/52 (78%), Gaps = 1/52 (1%) Frame = -2 Query: 153 KTTSSNPKTDLENTPPTHPNIPVNHH-LHSHPKTPFSHNDPPVKVVVRIRPE 1 K SSNPK++LEN PP + NIP+ H+ + SHPK+ FSHN+P VKVVVRI P+ Sbjct: 34 KPISSNPKSNLENVPPPNSNIPITHNQIQSHPKSQFSHNNPHVKVVVRISPD 85