BLASTX nr result
ID: Glycyrrhiza24_contig00030950
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00030950 (342 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003616419.1| hypothetical protein MTR_5g080040 [Medicago ... 74 2e-11 ref|XP_003616421.1| hypothetical protein MTR_5g080060 [Medicago ... 64 1e-08 >ref|XP_003616419.1| hypothetical protein MTR_5g080040 [Medicago truncatula] gi|355517754|gb|AES99377.1| hypothetical protein MTR_5g080040 [Medicago truncatula] Length = 72 Score = 73.6 bits (179), Expect = 2e-11 Identities = 34/68 (50%), Positives = 43/68 (63%) Frame = -1 Query: 312 MVKDVDEGCRTPRRSGCRIXXXXXXXXXXXXXXXXXPTRQRVPPKSGYFNPPDLELIFRV 133 M D++EGCRTP+ SGCRI T+++VPPK GYFNPPDLELIFRV Sbjct: 3 MKLDMEEGCRTPKHSGCRIPPATICPSAPKKKPVVYSTKKKVPPKDGYFNPPDLELIFRV 62 Query: 132 VVVPTREA 109 + + RE+ Sbjct: 63 LPIRERES 70 >ref|XP_003616421.1| hypothetical protein MTR_5g080060 [Medicago truncatula] gi|355517756|gb|AES99379.1| hypothetical protein MTR_5g080060 [Medicago truncatula] Length = 72 Score = 64.3 bits (155), Expect = 1e-08 Identities = 29/64 (45%), Positives = 39/64 (60%) Frame = -1 Query: 300 VDEGCRTPRRSGCRIXXXXXXXXXXXXXXXXXPTRQRVPPKSGYFNPPDLELIFRVVVVP 121 ++EGCRTP+ SGCRI +++ VPPK GYFN PDLELIFRV+ + Sbjct: 7 IEEGCRTPKHSGCRIPPSTMCPSAPKKKPVVYSSKKNVPPKDGYFNHPDLELIFRVLPIR 66 Query: 120 TREA 109 R++ Sbjct: 67 ERKS 70