BLASTX nr result
ID: Glycyrrhiza24_contig00030949
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00030949 (254 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFK41814.1| unknown [Lotus japonicus] 77 1e-12 ref|XP_002517816.1| tRNA-dihydrouridine synthase A, putative [Ri... 75 4e-12 ref|XP_003537164.1| PREDICTED: tRNA-dihydrouridine synthase A-li... 74 1e-11 ref|XP_003599259.1| hypothetical protein MTR_3g030870 [Medicago ... 74 1e-11 ref|XP_002314040.1| predicted protein [Populus trichocarpa] gi|2... 73 3e-11 >gb|AFK41814.1| unknown [Lotus japonicus] Length = 425 Score = 77.0 bits (188), Expect = 1e-12 Identities = 37/47 (78%), Positives = 39/47 (82%) Frame = -1 Query: 254 FEETLVAIPDSVLDSPVAEPPSGRRDLFANIGSLLPPPYRTGEEDAV 114 FEETLVAIPDSVLDSPV EP GRRDLFAN+ SLLPPPY T EE + Sbjct: 376 FEETLVAIPDSVLDSPVVEPTPGRRDLFANMDSLLPPPYTTREEAVI 422 >ref|XP_002517816.1| tRNA-dihydrouridine synthase A, putative [Ricinus communis] gi|223543088|gb|EEF44623.1| tRNA-dihydrouridine synthase A, putative [Ricinus communis] Length = 375 Score = 75.5 bits (184), Expect = 4e-12 Identities = 34/45 (75%), Positives = 39/45 (86%) Frame = -1 Query: 254 FEETLVAIPDSVLDSPVAEPPSGRRDLFANIGSLLPPPYRTGEED 120 FEETLVAIPD+VLDSP+AE PSGR+DLF N+ LLPPPY T E+D Sbjct: 327 FEETLVAIPDTVLDSPIAEAPSGRQDLFTNVRGLLPPPYATREQD 371 >ref|XP_003537164.1| PREDICTED: tRNA-dihydrouridine synthase A-like [Glycine max] Length = 372 Score = 74.3 bits (181), Expect = 1e-11 Identities = 36/47 (76%), Positives = 39/47 (82%) Frame = -1 Query: 254 FEETLVAIPDSVLDSPVAEPPSGRRDLFANIGSLLPPPYRTGEEDAV 114 FEETLVAIPDSVLDS V +P SGR D+FANI S LPPPYRT EED + Sbjct: 326 FEETLVAIPDSVLDSAVVKPQSGRGDIFANIYSSLPPPYRTREEDVI 372 >ref|XP_003599259.1| hypothetical protein MTR_3g030870 [Medicago truncatula] gi|355488307|gb|AES69510.1| hypothetical protein MTR_3g030870 [Medicago truncatula] Length = 102 Score = 74.3 bits (181), Expect = 1e-11 Identities = 37/46 (80%), Positives = 39/46 (84%) Frame = -1 Query: 251 EETLVAIPDSVLDSPVAEPPSGRRDLFANIGSLLPPPYRTGEEDAV 114 EETLVAIPDSVLDS A+ P GR DLFANI SLLPPPYRT +EDAV Sbjct: 54 EETLVAIPDSVLDSSFAKSPPGRGDLFANIDSLLPPPYRTRDEDAV 99 >ref|XP_002314040.1| predicted protein [Populus trichocarpa] gi|222850448|gb|EEE87995.1| predicted protein [Populus trichocarpa] Length = 380 Score = 72.8 bits (177), Expect = 3e-11 Identities = 35/47 (74%), Positives = 38/47 (80%) Frame = -1 Query: 254 FEETLVAIPDSVLDSPVAEPPSGRRDLFANIGSLLPPPYRTGEEDAV 114 FEETL AIPD+VLDSPVAE PSGR DLFAN+ LLPPPY T E+ V Sbjct: 329 FEETLAAIPDAVLDSPVAELPSGRIDLFANVRGLLPPPYETRTEEVV 375