BLASTX nr result
ID: Glycyrrhiza24_contig00030867
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00030867 (324 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003516750.1| PREDICTED: pentatricopeptide repeat-containi... 82 6e-14 ref|XP_003538651.1| PREDICTED: pentatricopeptide repeat-containi... 80 2e-13 emb|CBI35666.3| unnamed protein product [Vitis vinifera] 76 3e-12 emb|CAN69881.1| hypothetical protein VITISV_024112 [Vitis vinifera] 76 3e-12 ref|XP_003556972.1| PREDICTED: pentatricopeptide repeat-containi... 75 7e-12 >ref|XP_003516750.1| PREDICTED: pentatricopeptide repeat-containing protein At5g13270, chloroplastic-like [Glycine max] Length = 765 Score = 81.6 bits (200), Expect = 6e-14 Identities = 34/40 (85%), Positives = 36/40 (90%) Frame = -1 Query: 324 KDCHDFAKRVSIVTGREFVVRDANRFHHIKSGKCSCNEYW 205 KDCHDFAKRVSIVTGRE VVRD NRFHHI SG+CSC +YW Sbjct: 726 KDCHDFAKRVSIVTGRELVVRDGNRFHHINSGECSCRDYW 765 >ref|XP_003538651.1| PREDICTED: pentatricopeptide repeat-containing protein At5g13270, chloroplastic-like [Glycine max] Length = 753 Score = 79.7 bits (195), Expect = 2e-13 Identities = 32/40 (80%), Positives = 36/40 (90%) Frame = -1 Query: 324 KDCHDFAKRVSIVTGREFVVRDANRFHHIKSGKCSCNEYW 205 KDCH+FAKRVS+VTGRE VVRD NRFHHI SG+CSC +YW Sbjct: 714 KDCHEFAKRVSVVTGRELVVRDGNRFHHINSGECSCRDYW 753 >emb|CBI35666.3| unnamed protein product [Vitis vinifera] Length = 762 Score = 75.9 bits (185), Expect = 3e-12 Identities = 29/40 (72%), Positives = 36/40 (90%) Frame = -1 Query: 324 KDCHDFAKRVSIVTGREFVVRDANRFHHIKSGKCSCNEYW 205 +DCH+F K+VS+VTGR+ VVRD+ RFHH KSGKCSCN+YW Sbjct: 723 RDCHEFGKQVSMVTGRQIVVRDSTRFHHFKSGKCSCNDYW 762 >emb|CAN69881.1| hypothetical protein VITISV_024112 [Vitis vinifera] Length = 734 Score = 75.9 bits (185), Expect = 3e-12 Identities = 29/40 (72%), Positives = 36/40 (90%) Frame = -1 Query: 324 KDCHDFAKRVSIVTGREFVVRDANRFHHIKSGKCSCNEYW 205 +DCH+F K+VS+VTGR+ VVRD+ RFHH KSGKCSCN+YW Sbjct: 695 RDCHEFGKQVSMVTGRQIVVRDSTRFHHFKSGKCSCNDYW 734 >ref|XP_003556972.1| PREDICTED: pentatricopeptide repeat-containing protein At3g49170, chloroplastic-like [Glycine max] Length = 820 Score = 74.7 bits (182), Expect = 7e-12 Identities = 31/39 (79%), Positives = 33/39 (84%) Frame = -1 Query: 321 DCHDFAKRVSIVTGREFVVRDANRFHHIKSGKCSCNEYW 205 DCH K +SIVTGRE VVRDANRFHHIK GKCSCN+YW Sbjct: 782 DCHTAIKYISIVTGREIVVRDANRFHHIKDGKCSCNDYW 820