BLASTX nr result
ID: Glycyrrhiza24_contig00030741
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00030741 (234 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003540572.1| PREDICTED: endoglucanase 8-like [Glycine max] 57 2e-06 ref|XP_002510937.1| endo-1,4-beta-glucanase, putative [Ricinus c... 56 3e-06 ref|XP_003526224.1| PREDICTED: endoglucanase 8-like [Glycine max] 55 5e-06 ref|XP_002264710.2| PREDICTED: endoglucanase 8-like [Vitis vinif... 55 8e-06 emb|CBI24578.3| unnamed protein product [Vitis vinifera] 55 8e-06 >ref|XP_003540572.1| PREDICTED: endoglucanase 8-like [Glycine max] Length = 486 Score = 56.6 bits (135), Expect = 2e-06 Identities = 24/35 (68%), Positives = 28/35 (80%) Frame = -1 Query: 234 DDSYLDSRYNVTQSEPTTYINAPLVGVLAYLKNPS 130 DDS+ DSRYN QSEPTTY+NAP VG+LAY P+ Sbjct: 450 DDSFQDSRYNAGQSEPTTYVNAPFVGLLAYFNKPT 484 >ref|XP_002510937.1| endo-1,4-beta-glucanase, putative [Ricinus communis] gi|223550052|gb|EEF51539.1| endo-1,4-beta-glucanase, putative [Ricinus communis] Length = 506 Score = 55.8 bits (133), Expect = 3e-06 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = -1 Query: 234 DDSYLDSRYNVTQSEPTTYINAPLVGVLAYLK 139 +D Y+D R NV+QSEPTTYINAP VGVLAYLK Sbjct: 466 NDQYVDDRLNVSQSEPTTYINAPFVGVLAYLK 497 >ref|XP_003526224.1| PREDICTED: endoglucanase 8-like [Glycine max] Length = 476 Score = 55.5 bits (132), Expect = 5e-06 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = -1 Query: 234 DDSYLDSRYNVTQSEPTTYINAPLVGVLAY 145 DDS+ DSRYNV QSEPTTYINAP VG+LAY Sbjct: 440 DDSFQDSRYNVGQSEPTTYINAPFVGLLAY 469 >ref|XP_002264710.2| PREDICTED: endoglucanase 8-like [Vitis vinifera] Length = 497 Score = 54.7 bits (130), Expect = 8e-06 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = -1 Query: 234 DDSYLDSRYNVTQSEPTTYINAPLVGVLAYLK 139 DDSY DSR +V+QSEP TYINAPLVG+LAY K Sbjct: 463 DDSYADSRADVSQSEPATYINAPLVGLLAYFK 494 >emb|CBI24578.3| unnamed protein product [Vitis vinifera] Length = 486 Score = 54.7 bits (130), Expect = 8e-06 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = -1 Query: 234 DDSYLDSRYNVTQSEPTTYINAPLVGVLAYLK 139 DDSY DSR +V+QSEP TYINAPLVG+LAY K Sbjct: 452 DDSYADSRADVSQSEPATYINAPLVGLLAYFK 483