BLASTX nr result
ID: Glycyrrhiza24_contig00030729
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00030729 (270 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003524064.1| PREDICTED: pentatricopeptide repeat-containi... 72 6e-11 ref|XP_002522032.1| pentatricopeptide repeat-containing protein,... 58 9e-07 ref|XP_004142520.1| PREDICTED: pentatricopeptide repeat-containi... 56 3e-06 >ref|XP_003524064.1| PREDICTED: pentatricopeptide repeat-containing protein At5g18390, mitochondrial-like [Glycine max] Length = 450 Score = 71.6 bits (174), Expect = 6e-11 Identities = 39/63 (61%), Positives = 51/63 (80%), Gaps = 2/63 (3%) Frame = -3 Query: 184 LLQAFAKLIILTSKPLVVHPHLYSIRRTLT--SSAKDEYFAAIQHVANIVRRDFYMERTL 11 +LQ +KLI+ SKP ++ +L+SI +TLT SS++DEYFA I HV+NIVRRDFY+ERTL Sbjct: 1 MLQTCSKLILRHSKPRLLL-NLHSITKTLTTASSSRDEYFAVIHHVSNIVRRDFYLERTL 59 Query: 10 NKL 2 NKL Sbjct: 60 NKL 62 >ref|XP_002522032.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223538836|gb|EEF40436.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 451 Score = 57.8 bits (138), Expect = 9e-07 Identities = 32/59 (54%), Positives = 39/59 (66%), Gaps = 4/59 (6%) Frame = -3 Query: 166 KLIIL--TSKPLVVHP--HLYSIRRTLTSSAKDEYFAAIQHVANIVRRDFYMERTLNKL 2 KL IL T+ + + P HL + T T++ KD YFA I H+ NIVRRDFY ERTLNKL Sbjct: 6 KLFILPKTTATVTLQPLRHLKVLASTSTNNTKDAYFALIHHITNIVRRDFYPERTLNKL 64 >ref|XP_004142520.1| PREDICTED: pentatricopeptide repeat-containing protein At5g18390, mitochondrial-like [Cucumis sativus] gi|449518358|ref|XP_004166209.1| PREDICTED: pentatricopeptide repeat-containing protein At5g18390, mitochondrial-like [Cucumis sativus] Length = 455 Score = 55.8 bits (133), Expect = 3e-06 Identities = 24/32 (75%), Positives = 30/32 (93%) Frame = -3 Query: 97 TSSAKDEYFAAIQHVANIVRRDFYMERTLNKL 2 T+ +KD+YFAAI H+++IVRRDFYMERTLNKL Sbjct: 34 TAPSKDDYFAAIHHISHIVRRDFYMERTLNKL 65