BLASTX nr result
ID: Glycyrrhiza24_contig00030672
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00030672 (276 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003551820.1| PREDICTED: pentatricopeptide repeat-containi... 68 7e-10 ref|XP_003599019.1| Pentatricopeptide repeat-containing protein ... 65 4e-09 >ref|XP_003551820.1| PREDICTED: pentatricopeptide repeat-containing protein At2g39620-like [Glycine max] Length = 887 Score = 68.2 bits (165), Expect = 7e-10 Identities = 35/54 (64%), Positives = 39/54 (72%) Frame = +3 Query: 111 KDVASCKSIHSYGVRRYNCGVGPNSLPAMYSKCGEEYLAHRIFDRTLVYNDISW 272 +DV SCKSIH Y VRR GV NSL MYSKCGE LAH+IFD+ V +DISW Sbjct: 243 EDVDSCKSIHGYVVRRCVFGVVSNSLIDMYSKCGEVKLAHQIFDQMWVKDDISW 296 >ref|XP_003599019.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355488067|gb|AES69270.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 944 Score = 65.5 bits (158), Expect = 4e-09 Identities = 31/53 (58%), Positives = 36/53 (67%) Frame = +3 Query: 114 DVASCKSIHSYGVRRYNCGVGPNSLPAMYSKCGEEYLAHRIFDRTLVYNDISW 272 DV CKSIH Y VRR CGV NSL MY KCG+ + A R+FDR V +D+SW Sbjct: 215 DVGCCKSIHGYVVRRSICGVVSNSLIDMYCKCGDVHSAQRVFDRMGVRDDVSW 267