BLASTX nr result
ID: Glycyrrhiza24_contig00030625
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00030625 (279 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003541398.1| PREDICTED: pentatricopeptide repeat-containi... 135 3e-30 ref|XP_002273893.1| PREDICTED: pentatricopeptide repeat-containi... 131 6e-29 ref|XP_002308496.1| predicted protein [Populus trichocarpa] gi|2... 126 2e-27 ref|XP_002525211.1| pentatricopeptide repeat-containing protein,... 119 3e-25 ref|XP_004137952.1| PREDICTED: pentatricopeptide repeat-containi... 115 3e-24 >ref|XP_003541398.1| PREDICTED: pentatricopeptide repeat-containing protein At2g37310-like [Glycine max] Length = 667 Score = 135 bits (341), Expect = 3e-30 Identities = 68/91 (74%), Positives = 77/91 (84%) Frame = -3 Query: 274 ERDEVSYGSIISGYMVYGFVEKALDVFRGMGNPGLSTWNAVISGMVQNNRFEGVLDLVRE 95 E+DEV+YG+IISGYM YG V+ A+ VFRG+ NPGL+ WNAVISGMVQN +FEGV DLVR+ Sbjct: 304 EKDEVTYGAIISGYMDYGLVDDAMGVFRGVENPGLNMWNAVISGMVQNKQFEGVFDLVRQ 363 Query: 94 MMLGYGLKPNAVTLASILPLFSQFSNLRGGK 2 M G GL PNAVTLASILP FS FSNLRGGK Sbjct: 364 MQ-GSGLSPNAVTLASILPSFSYFSNLRGGK 393 >ref|XP_002273893.1| PREDICTED: pentatricopeptide repeat-containing protein At2g37310-like [Vitis vinifera] Length = 667 Score = 131 bits (329), Expect = 6e-29 Identities = 64/92 (69%), Positives = 79/92 (85%) Frame = -3 Query: 277 SERDEVSYGSIISGYMVYGFVEKALDVFRGMGNPGLSTWNAVISGMVQNNRFEGVLDLVR 98 S +DEV+YGSI+SGYM +GFV+KA+D+FR M NP LSTWNAVISG+VQNN EG+L+LV+ Sbjct: 303 SNKDEVTYGSIVSGYMTHGFVDKAMDLFREMKNPRLSTWNAVISGLVQNNCNEGILELVQ 362 Query: 97 EMMLGYGLKPNAVTLASILPLFSQFSNLRGGK 2 EM +G +PNAVTL+SILP FS FSNL+GGK Sbjct: 363 EMQ-EFGFRPNAVTLSSILPTFSCFSNLKGGK 393 >ref|XP_002308496.1| predicted protein [Populus trichocarpa] gi|222854472|gb|EEE92019.1| predicted protein [Populus trichocarpa] Length = 621 Score = 126 bits (317), Expect = 2e-27 Identities = 62/92 (67%), Positives = 77/92 (83%) Frame = -3 Query: 277 SERDEVSYGSIISGYMVYGFVEKALDVFRGMGNPGLSTWNAVISGMVQNNRFEGVLDLVR 98 SE+DEV+YG+IISGYM +G V+K +++FR M + LSTWNAVISG+VQNNR EGV+DLVR Sbjct: 288 SEKDEVTYGAIISGYMAHGVVDKGMELFREMKSRVLSTWNAVISGLVQNNRHEGVVDLVR 347 Query: 97 EMMLGYGLKPNAVTLASILPLFSQFSNLRGGK 2 EM G G +PNAVTL+S+LP S FSNL+GGK Sbjct: 348 EMQ-GLGFRPNAVTLSSVLPTLSYFSNLKGGK 378 >ref|XP_002525211.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223535508|gb|EEF37177.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 654 Score = 119 bits (298), Expect = 3e-25 Identities = 58/92 (63%), Positives = 77/92 (83%) Frame = -3 Query: 277 SERDEVSYGSIISGYMVYGFVEKALDVFRGMGNPGLSTWNAVISGMVQNNRFEGVLDLVR 98 SE+DEV+YG+IISG M++G+V+++L++FRGM LSTWNAVI+G+VQNNR EGVLDLVR Sbjct: 290 SEKDEVTYGAIISGLMLHGYVDQSLELFRGMKTQILSTWNAVITGLVQNNRHEGVLDLVR 349 Query: 97 EMMLGYGLKPNAVTLASILPLFSQFSNLRGGK 2 EM G +PNAVTL+S+L + FS+L+GGK Sbjct: 350 EMQ-ALGFRPNAVTLSSVLSTIAYFSSLKGGK 380 >ref|XP_004137952.1| PREDICTED: pentatricopeptide repeat-containing protein At2g37310-like [Cucumis sativus] Length = 595 Score = 115 bits (289), Expect = 3e-24 Identities = 56/91 (61%), Positives = 71/91 (78%) Frame = -3 Query: 274 ERDEVSYGSIISGYMVYGFVEKALDVFRGMGNPGLSTWNAVISGMVQNNRFEGVLDLVRE 95 E+D ++Y S+ISGYMV+GFV +A+D+FR P L TWNAVISG+VQNNR EG +D+ R Sbjct: 273 EKDAITYCSMISGYMVHGFVNQAMDLFREQERPRLPTWNAVISGLVQNNRQEGAVDIFRA 332 Query: 94 MMLGYGLKPNAVTLASILPLFSQFSNLRGGK 2 M +G +PN VTLASILP+FS FS L+GGK Sbjct: 333 MQ-SHGCRPNTVTLASILPVFSHFSTLKGGK 362