BLASTX nr result
ID: Glycyrrhiza24_contig00030600
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00030600 (307 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003538647.1| PREDICTED: pentatricopeptide repeat-containi... 71 1e-10 >ref|XP_003538647.1| PREDICTED: pentatricopeptide repeat-containing protein At3g22690-like [Glycine max] Length = 836 Score = 70.9 bits (172), Expect = 1e-10 Identities = 40/66 (60%), Positives = 45/66 (68%), Gaps = 1/66 (1%) Frame = -2 Query: 195 MATTLLHPSPVLLVPTSQKEPKAMTTTNPSPNNKSLVKNCKTLKELRQLHCDMMKKG-LC 19 MATTL PS LLVP S KE +T + S L+ NCKTLKEL+QLHCDMMKKG LC Sbjct: 1 MATTLF-PSSTLLVPASLKEANPITRNSSS----KLLVNCKTLKELKQLHCDMMKKGLLC 55 Query: 18 HKPGGD 1 HKP + Sbjct: 56 HKPASN 61