BLASTX nr result
ID: Glycyrrhiza24_contig00030560
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00030560 (294 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003547291.1| PREDICTED: trihelix transcription factor GT-... 69 4e-10 ref|XP_003534745.1| PREDICTED: trihelix transcription factor GT-... 69 4e-10 ref|XP_002965455.1| hypothetical protein SELMODRAFT_85122 [Selag... 55 8e-06 ref|XP_002984536.1| hypothetical protein SELMODRAFT_120369 [Sela... 55 8e-06 >ref|XP_003547291.1| PREDICTED: trihelix transcription factor GT-2-like [Glycine max] Length = 338 Score = 68.9 bits (167), Expect = 4e-10 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = -2 Query: 293 NKYYKRTVGSGKKRPQNSKTCPYFDELDILYR 198 NKYYKRT+GSGKKR QNSKTCPYFDELDILYR Sbjct: 280 NKYYKRTIGSGKKRRQNSKTCPYFDELDILYR 311 >ref|XP_003534745.1| PREDICTED: trihelix transcription factor GT-2-like [Glycine max] Length = 338 Score = 68.9 bits (167), Expect = 4e-10 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = -2 Query: 293 NKYYKRTVGSGKKRPQNSKTCPYFDELDILYR 198 NKYYKRT+GSGKKR QNSKTCPYFDELDILYR Sbjct: 280 NKYYKRTIGSGKKRRQNSKTCPYFDELDILYR 311 >ref|XP_002965455.1| hypothetical protein SELMODRAFT_85122 [Selaginella moellendorffii] gi|300166269|gb|EFJ32875.1| hypothetical protein SELMODRAFT_85122 [Selaginella moellendorffii] Length = 324 Score = 54.7 bits (130), Expect = 8e-06 Identities = 22/32 (68%), Positives = 27/32 (84%) Frame = -2 Query: 293 NKYYKRTVGSGKKRPQNSKTCPYFDELDILYR 198 NKY+++T S KKRP+NSKTCPYF +LD LYR Sbjct: 288 NKYFRKTKDSSKKRPENSKTCPYFHQLDALYR 319 >ref|XP_002984536.1| hypothetical protein SELMODRAFT_120369 [Selaginella moellendorffii] gi|300147924|gb|EFJ14586.1| hypothetical protein SELMODRAFT_120369 [Selaginella moellendorffii] Length = 325 Score = 54.7 bits (130), Expect = 8e-06 Identities = 22/32 (68%), Positives = 27/32 (84%) Frame = -2 Query: 293 NKYYKRTVGSGKKRPQNSKTCPYFDELDILYR 198 NKY+++T S KKRP+NSKTCPYF +LD LYR Sbjct: 289 NKYFRKTKDSSKKRPENSKTCPYFHQLDALYR 320