BLASTX nr result
ID: Glycyrrhiza24_contig00030473
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00030473 (226 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003542877.1| PREDICTED: glucose-6-phosphate/phosphate tra... 142 4e-32 ref|XP_003546137.1| PREDICTED: glucose-6-phosphate/phosphate tra... 142 4e-32 ref|XP_004142557.1| PREDICTED: glucose-6-phosphate/phosphate tra... 141 6e-32 ref|XP_003610399.1| Glucose-6-phosphate/phosphate translocator [... 139 2e-31 gb|ABO87607.1| chloroplast glucose-6-phosphate/phosphate translo... 139 2e-31 >ref|XP_003542877.1| PREDICTED: glucose-6-phosphate/phosphate translocator 2, chloroplastic-like [Glycine max] Length = 391 Score = 142 bits (357), Expect = 4e-32 Identities = 70/75 (93%), Positives = 73/75 (97%) Frame = +2 Query: 2 GEPAFSVLVSRFLLGEAFPLPVYLSLVPIIGGCALTAVTELNFNMTGFMGAMISNVAFVF 181 GEPAFSVLVSRFLLGEAFP+PVYLSL+PIIGGCAL AVTELNFNM GFMGAMISN+AFVF Sbjct: 197 GEPAFSVLVSRFLLGEAFPMPVYLSLLPIIGGCALAAVTELNFNMIGFMGAMISNLAFVF 256 Query: 182 RNIFSKKGMKGMSVS 226 RNIFSKKGMKGMSVS Sbjct: 257 RNIFSKKGMKGMSVS 271 >ref|XP_003546137.1| PREDICTED: glucose-6-phosphate/phosphate translocator 2, chloroplastic-like [Glycine max] Length = 391 Score = 142 bits (357), Expect = 4e-32 Identities = 70/75 (93%), Positives = 73/75 (97%) Frame = +2 Query: 2 GEPAFSVLVSRFLLGEAFPLPVYLSLVPIIGGCALTAVTELNFNMTGFMGAMISNVAFVF 181 GEPAFSVLVSRFLLGEAFP+PVYLSL+PIIGGCAL AVTELNFNM GFMGAMISN+AFVF Sbjct: 197 GEPAFSVLVSRFLLGEAFPMPVYLSLLPIIGGCALAAVTELNFNMIGFMGAMISNLAFVF 256 Query: 182 RNIFSKKGMKGMSVS 226 RNIFSKKGMKGMSVS Sbjct: 257 RNIFSKKGMKGMSVS 271 >ref|XP_004142557.1| PREDICTED: glucose-6-phosphate/phosphate translocator 2, chloroplastic-like [Cucumis sativus] gi|449485377|ref|XP_004157149.1| PREDICTED: glucose-6-phosphate/phosphate translocator 2, chloroplastic-like [Cucumis sativus] Length = 396 Score = 141 bits (355), Expect = 6e-32 Identities = 70/75 (93%), Positives = 72/75 (96%) Frame = +2 Query: 2 GEPAFSVLVSRFLLGEAFPLPVYLSLVPIIGGCALTAVTELNFNMTGFMGAMISNVAFVF 181 GEPAFSVLVSRFLLGE FPLPVYLSL+PIIGGCAL AVTELNFNMTGFMGAMISN+AFVF Sbjct: 202 GEPAFSVLVSRFLLGETFPLPVYLSLLPIIGGCALAAVTELNFNMTGFMGAMISNLAFVF 261 Query: 182 RNIFSKKGMKGMSVS 226 RNIFSKKGMKG SVS Sbjct: 262 RNIFSKKGMKGKSVS 276 >ref|XP_003610399.1| Glucose-6-phosphate/phosphate translocator [Medicago truncatula] gi|355511454|gb|AES92596.1| Glucose-6-phosphate/phosphate translocator [Medicago truncatula] Length = 1051 Score = 139 bits (351), Expect = 2e-31 Identities = 70/75 (93%), Positives = 72/75 (96%) Frame = +2 Query: 2 GEPAFSVLVSRFLLGEAFPLPVYLSLVPIIGGCALTAVTELNFNMTGFMGAMISNVAFVF 181 GEPAFSVLVS+FLLGEAFPL VYLSL+PIIGGCAL AVTELNFNM GFMGAMISNVAFVF Sbjct: 198 GEPAFSVLVSKFLLGEAFPLQVYLSLLPIIGGCALAAVTELNFNMIGFMGAMISNVAFVF 257 Query: 182 RNIFSKKGMKGMSVS 226 RNIFSKKGMKGMSVS Sbjct: 258 RNIFSKKGMKGMSVS 272 >gb|ABO87607.1| chloroplast glucose-6-phosphate/phosphate translocator [Pisum sativum] Length = 385 Score = 139 bits (351), Expect = 2e-31 Identities = 70/75 (93%), Positives = 72/75 (96%) Frame = +2 Query: 2 GEPAFSVLVSRFLLGEAFPLPVYLSLVPIIGGCALTAVTELNFNMTGFMGAMISNVAFVF 181 GEPAFSVLVSRFLLGE+FPL VYLSL+PIIGGCAL AVTELNFNM GFMGAMISNVAFVF Sbjct: 191 GEPAFSVLVSRFLLGESFPLQVYLSLLPIIGGCALAAVTELNFNMIGFMGAMISNVAFVF 250 Query: 182 RNIFSKKGMKGMSVS 226 RNIFSKKGMKGMSVS Sbjct: 251 RNIFSKKGMKGMSVS 265