BLASTX nr result
ID: Glycyrrhiza24_contig00030422
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00030422 (442 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003597936.1| Sodium-coupled neutral amino acid transporte... 74 1e-11 ref|XP_003543691.1| PREDICTED: sodium-coupled neutral amino acid... 71 1e-10 ref|XP_003546923.1| PREDICTED: sodium-coupled neutral amino acid... 68 7e-10 >ref|XP_003597936.1| Sodium-coupled neutral amino acid transporter [Medicago truncatula] gi|355486984|gb|AES68187.1| Sodium-coupled neutral amino acid transporter [Medicago truncatula] Length = 496 Score = 74.3 bits (181), Expect = 1e-11 Identities = 39/57 (68%), Positives = 45/57 (78%), Gaps = 2/57 (3%) Frame = +2 Query: 278 MSHRKEGNYTSIPV--SSYLELQPQTESPNSLQRLSFDETGNGGYLGSKVVDEDDDD 442 MSH+ + NYTSIPV SSYLELQPQ +S NS QRLSFDE GG+LGSKV +D+DD Sbjct: 1 MSHKNDSNYTSIPVSSSSYLELQPQNDSSNSFQRLSFDE--GGGFLGSKVDVDDEDD 55 >ref|XP_003543691.1| PREDICTED: sodium-coupled neutral amino acid transporter 4-like [Glycine max] Length = 485 Score = 70.9 bits (172), Expect = 1e-10 Identities = 37/56 (66%), Positives = 45/56 (80%), Gaps = 1/56 (1%) Frame = +2 Query: 278 MSHRKEGN-YTSIPVSSYLELQPQTESPNSLQRLSFDETGNGGYLGSKVVDEDDDD 442 MSHRK+ N Y+S+P+SSYLELQPQ +S SLQR +FDE + YLGSKV D+DDDD Sbjct: 1 MSHRKDNNNYSSLPISSYLELQPQNDSSKSLQRPTFDE--SEVYLGSKVDDDDDDD 54 >ref|XP_003546923.1| PREDICTED: sodium-coupled neutral amino acid transporter 4-like [Glycine max] Length = 485 Score = 68.2 bits (165), Expect = 7e-10 Identities = 36/56 (64%), Positives = 44/56 (78%), Gaps = 1/56 (1%) Frame = +2 Query: 278 MSHRKE-GNYTSIPVSSYLELQPQTESPNSLQRLSFDETGNGGYLGSKVVDEDDDD 442 MSHRK+ NY+S+P+SSYLELQPQ +S SLQR +FDE + YLGSKV +DDDD Sbjct: 1 MSHRKDTNNYSSLPISSYLELQPQNDSSKSLQRPTFDE--SEVYLGSKVDHDDDDD 54