BLASTX nr result
ID: Glycyrrhiza24_contig00030170
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00030170 (311 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_197032.1| pentatricopeptide repeat-containing protein [Ar... 57 2e-06 ref|XP_003553062.1| PREDICTED: pentatricopeptide repeat-containi... 56 3e-06 ref|XP_002871658.1| pentatricopeptide repeat-containing protein ... 56 3e-06 >ref|NP_197032.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75180846|sp|Q9LXF4.1|PP384_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At5g15280 gi|7671497|emb|CAB89338.1| putative protein [Arabidopsis thaliana] gi|332004760|gb|AED92143.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 1227 Score = 57.0 bits (136), Expect = 2e-06 Identities = 34/65 (52%), Positives = 41/65 (63%) Frame = +2 Query: 110 SLLSREPSLSNNARARAGSSLKTHLLELFTVVPGITRQFWRVPALRPEHVLQILLGFQSE 289 +LLSR S R GSSLK L +L VVP ITR+F R P L+PE VL++ LGF+SE Sbjct: 60 NLLSR----SKEKRDLTGSSLKDLLFDLSDVVPNITRRFRRFPGLKPEDVLELSLGFESE 115 Query: 290 CVRVG 304 R G Sbjct: 116 LQRGG 120 >ref|XP_003553062.1| PREDICTED: pentatricopeptide repeat-containing protein At5g15280-like [Glycine max] Length = 1186 Score = 56.2 bits (134), Expect = 3e-06 Identities = 31/56 (55%), Positives = 34/56 (60%) Frame = +2 Query: 134 LSNNARARAGSSLKTHLLELFTVVPGITRQFWRVPALRPEHVLQILLGFQSECVRV 301 L NNA SLK HLLEL +P TR WR+PAL P HVLQ+LL QS V V Sbjct: 33 LDNNA------SLKPHLLELSLAIPETTRTCWRLPALGPSHVLQLLLALQSHSVTV 82 >ref|XP_002871658.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297317495|gb|EFH47917.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 1223 Score = 56.2 bits (134), Expect = 3e-06 Identities = 32/63 (50%), Positives = 42/63 (66%) Frame = +2 Query: 110 SLLSREPSLSNNARARAGSSLKTHLLELFTVVPGITRQFWRVPALRPEHVLQILLGFQSE 289 +LLSR SN GSSLK LL+L V+P I R+F R P L+PE+V+++LLGF+SE Sbjct: 56 NLLSR----SNEKLDLTGSSLKDLLLDLSDVIPNIIRRFRRFPGLKPENVVELLLGFESE 111 Query: 290 CVR 298 R Sbjct: 112 LQR 114