BLASTX nr result
ID: Glycyrrhiza24_contig00030111
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00030111 (343 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_001892072.1| T-cell receptor beta chain ANA 11 [Brugia ma... 55 6e-06 >ref|XP_001892072.1| T-cell receptor beta chain ANA 11 [Brugia malayi] gi|158602929|gb|EDP39111.1| T-cell receptor beta chain ANA 11, putative [Brugia malayi] Length = 90 Score = 55.1 bits (131), Expect = 6e-06 Identities = 23/50 (46%), Positives = 30/50 (60%) Frame = +1 Query: 109 THTLPWSHTHTNTHSHFRGHTNTQTHSEFRGHNSTASHTTNTYHTLMRKY 258 THT +HTHT+TH+H HT+T TH+ H T +HT HT + KY Sbjct: 21 THTHTHTHTHTHTHTHTHTHTHTHTHTHTHTHTHTHTHTHTYIHTYIHKY 70