BLASTX nr result
ID: Glycyrrhiza24_contig00030066
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00030066 (350 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003532611.1| PREDICTED: 10-deacetylbaccatin III 10-O-acet... 74 2e-11 ref|XP_003543920.1| PREDICTED: taxadien-5-alpha-ol O-acetyltrans... 68 7e-10 ref|XP_004134932.1| PREDICTED: pentatricopeptide repeat-containi... 61 2e-09 ref|XP_002308572.1| predicted protein [Populus trichocarpa] gi|2... 58 2e-09 ref|XP_003564043.1| PREDICTED: pentatricopeptide repeat-containi... 57 3e-08 >ref|XP_003532611.1| PREDICTED: 10-deacetylbaccatin III 10-O-acetyltransferase-like [Glycine max] Length = 472 Score = 73.6 bits (179), Expect = 2e-11 Identities = 35/48 (72%), Positives = 40/48 (83%) Frame = +1 Query: 205 GRLVKHADGKLRVHCGAEYGVPFVEAIANRDLSSLHYLDGTDTEIAKH 348 G+LVKHADGKLR++C E GVPF+EAI N +LSSL YLDG D EIAKH Sbjct: 85 GKLVKHADGKLRINCNTE-GVPFIEAICNCNLSSLRYLDGNDVEIAKH 131 >ref|XP_003543920.1| PREDICTED: taxadien-5-alpha-ol O-acetyltransferase-like [Glycine max] Length = 462 Score = 68.2 bits (165), Expect = 7e-10 Identities = 31/48 (64%), Positives = 38/48 (79%) Frame = +1 Query: 205 GRLVKHADGKLRVHCGAEYGVPFVEAIANRDLSSLHYLDGTDTEIAKH 348 G+LV+HADGK R++C +E GVPF+EAI N LSS+HYLD D EI KH Sbjct: 85 GKLVRHADGKFRINCNSE-GVPFIEAICNCSLSSIHYLDCNDVEIGKH 131 >ref|XP_004134932.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Cucumis sativus] gi|449479547|ref|XP_004155632.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Cucumis sativus] Length = 638 Score = 60.8 bits (146), Expect(2) = 2e-09 Identities = 32/54 (59%), Positives = 39/54 (72%) Frame = +3 Query: 6 EHRETLAITTFGVLATAVGDCIGIVKILKNLRVWEDCHEVCKFVSKVFDREIVI 167 EH E LAI FG+L T GDCI +I+KNLRV DCHEV K +S VF+REI++ Sbjct: 569 EHSERLAIA-FGLLVTKDGDCI---RIIKNLRVCGDCHEVSKIISLVFEREIIV 618 Score = 26.2 bits (56), Expect(2) = 2e-09 Identities = 9/12 (75%), Positives = 11/12 (91%) Frame = +1 Query: 172 RGGNRFHHFKEG 207 R G+RFHHFK+G Sbjct: 619 RDGSRFHHFKKG 630 >ref|XP_002308572.1| predicted protein [Populus trichocarpa] gi|222854548|gb|EEE92095.1| predicted protein [Populus trichocarpa] Length = 433 Score = 58.2 bits (139), Expect(2) = 2e-09 Identities = 30/53 (56%), Positives = 38/53 (71%) Frame = +3 Query: 9 HRETLAITTFGVLATAVGDCIGIVKILKNLRVWEDCHEVCKFVSKVFDREIVI 167 H E LAI FG+L T G CI +I+KNLRV DCHEV K +S+VF+REI++ Sbjct: 365 HSERLAIA-FGLLVTGPGSCI---RIVKNLRVCWDCHEVTKMISRVFEREIIV 413 Score = 28.5 bits (62), Expect(2) = 2e-09 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = +1 Query: 172 RGGNRFHHFKEGR 210 R G+RFHHFKEG+ Sbjct: 414 RDGSRFHHFKEGK 426 >ref|XP_003564043.1| PREDICTED: pentatricopeptide repeat-containing protein At5g06540-like [Brachypodium distachyon] Length = 599 Score = 57.4 bits (137), Expect(2) = 3e-08 Identities = 31/53 (58%), Positives = 37/53 (69%) Frame = +3 Query: 9 HRETLAITTFGVLATAVGDCIGIVKILKNLRVWEDCHEVCKFVSKVFDREIVI 167 H E LAI FG+L T GD V+I KNLRV DCHE KF+S+VF+REIV+ Sbjct: 531 HSEKLAIA-FGLLRTRPGDT---VRITKNLRVCRDCHEATKFISRVFEREIVV 579 Score = 25.4 bits (54), Expect(2) = 3e-08 Identities = 9/12 (75%), Positives = 10/12 (83%) Frame = +1 Query: 172 RGGNRFHHFKEG 207 R NRFHHFK+G Sbjct: 580 RDRNRFHHFKDG 591