BLASTX nr result
ID: Glycyrrhiza24_contig00029986
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00029986 (423 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003525930.1| PREDICTED: nuclear pore complex protein Nup2... 92 4e-17 ref|XP_003625502.1| Nuclear pore complex protein Nup205 [Medicag... 81 8e-14 ref|XP_003633105.1| PREDICTED: nuclear pore complex protein Nup2... 74 2e-11 emb|CBI28192.3| unnamed protein product [Vitis vinifera] 70 2e-10 >ref|XP_003525930.1| PREDICTED: nuclear pore complex protein Nup205-like [Glycine max] Length = 1931 Score = 92.0 bits (227), Expect = 4e-17 Identities = 44/55 (80%), Positives = 50/55 (90%) Frame = +2 Query: 107 KIKES*DKVMSVLSPYPVVGSHDFAQDRSSNSLHGTETGPSPFNSILDFVSKIYQ 271 KIKES +++MSVLSPY VVGSHDFAQD +S+SLHGTE GP PFNSILDFVS+IYQ Sbjct: 405 KIKESKERIMSVLSPYRVVGSHDFAQDSNSSSLHGTEMGPLPFNSILDFVSEIYQ 459 >ref|XP_003625502.1| Nuclear pore complex protein Nup205 [Medicago truncatula] gi|355500517|gb|AES81720.1| Nuclear pore complex protein Nup205 [Medicago truncatula] Length = 2047 Score = 81.3 bits (199), Expect = 8e-14 Identities = 42/54 (77%), Positives = 45/54 (83%) Frame = +2 Query: 107 KIKES*DKVMSVLSPYPVVGSHDFAQDRSSNSLHGTETGPSPFNSILDFVSKIY 268 KIKES +KVMSVLSPY VVGSHDFAQ+ SS S GTE G PFNSILDFVS+IY Sbjct: 510 KIKESKEKVMSVLSPYRVVGSHDFAQNSSSVSQQGTEAGSLPFNSILDFVSEIY 563 >ref|XP_003633105.1| PREDICTED: nuclear pore complex protein Nup205-like [Vitis vinifera] Length = 1934 Score = 73.6 bits (179), Expect = 2e-11 Identities = 34/66 (51%), Positives = 45/66 (68%) Frame = +2 Query: 86 WCQQIPIKIKES*DKVMSVLSPYPVVGSHDFAQDRSSNSLHGTETGPSPFNSILDFVSKI 265 W +P ++KE+ +K MSVLSPY +VGSHDF D +SNS E G PF S+L+FVS++ Sbjct: 462 WNSLVPPRVKETKEKAMSVLSPYRMVGSHDFMHDNNSNSQKAVEMGSQPFVSLLEFVSEV 521 Query: 266 YQATNE 283 YQ E Sbjct: 522 YQKEPE 527 >emb|CBI28192.3| unnamed protein product [Vitis vinifera] Length = 1889 Score = 69.7 bits (169), Expect = 2e-10 Identities = 33/59 (55%), Positives = 42/59 (71%) Frame = +2 Query: 107 KIKES*DKVMSVLSPYPVVGSHDFAQDRSSNSLHGTETGPSPFNSILDFVSKIYQATNE 283 K+KE+ +K MSVLSPY +VGSHDF D +SNS E G PF S+L+FVS++YQ E Sbjct: 405 KVKETKEKAMSVLSPYRMVGSHDFMHDNNSNSQKAVEMGSQPFVSLLEFVSEVYQKEPE 463