BLASTX nr result
ID: Glycyrrhiza24_contig00029931
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00029931 (295 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003627859.1| Pentatricopeptide repeat-containing protein ... 84 9e-15 ref|XP_003545840.1| PREDICTED: pentatricopeptide repeat-containi... 71 1e-10 >ref|XP_003627859.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355521881|gb|AET02335.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 731 Score = 84.3 bits (207), Expect = 9e-15 Identities = 49/81 (60%), Positives = 51/81 (62%) Frame = -2 Query: 246 KIYRCFSDPDDGSENKVSQMFWDHVVERGLMSRNTMNKIQQMLI**QSCCLSNPSRLEDS 67 KIYRCFS D S+NKVSQMFWDHVVERGLMSRNTM KIQQM Sbjct: 549 KIYRCFSALD-ASQNKVSQMFWDHVVERGLMSRNTMYKIQQMPF---------------- 591 Query: 66 SYNCRLCIASGYQRVFLHVFT 4 I+SGYQRVFLHVFT Sbjct: 592 -------ISSGYQRVFLHVFT 605 >ref|XP_003545840.1| PREDICTED: pentatricopeptide repeat-containing protein At5g38730-like [Glycine max] Length = 587 Score = 70.9 bits (172), Expect = 1e-10 Identities = 33/44 (75%), Positives = 39/44 (88%) Frame = -2 Query: 246 KIYRCFSDPDDGSENKVSQMFWDHVVERGLMSRNTMNKIQQMLI 115 K+YRCFS D +ENKVSQ+FW+HV++RGLMSRNTMNKIQQ LI Sbjct: 545 KLYRCFST-SDANENKVSQIFWNHVMDRGLMSRNTMNKIQQKLI 587