BLASTX nr result
ID: Glycyrrhiza24_contig00029847
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00029847 (383 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI38148.3| unnamed protein product [Vitis vinifera] 43 5e-08 >emb|CBI38148.3| unnamed protein product [Vitis vinifera] Length = 288 Score = 43.1 bits (100), Expect(2) = 5e-08 Identities = 21/25 (84%), Positives = 23/25 (92%) Frame = +3 Query: 171 LLKIQFKRPYLVSQAFVIVSQLSRA 245 LL IQFKRPYLVSQAFVI ++LSRA Sbjct: 218 LLNIQFKRPYLVSQAFVIFNKLSRA 242 Score = 38.9 bits (89), Expect(2) = 5e-08 Identities = 24/44 (54%), Positives = 27/44 (61%), Gaps = 1/44 (2%) Frame = +1 Query: 247 EAPCESVNLRSMPQHNKRMVPYAFHSFRKGKKKSTP-IMVNLPL 375 EA CES+NLRSMPQ K F +GK+K P IMVNL L Sbjct: 243 EASCESINLRSMPQ-QKGWTHMHFILIGRGKRKKIPLIMVNLTL 285