BLASTX nr result
ID: Glycyrrhiza24_contig00029734
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00029734 (309 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003610900.1| Pentatricopeptide repeat-containing protein ... 67 1e-09 ref|XP_003538665.1| PREDICTED: pentatricopeptide repeat-containi... 66 3e-09 >ref|XP_003610900.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355512235|gb|AES93858.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 1508 Score = 67.0 bits (162), Expect = 1e-09 Identities = 36/70 (51%), Positives = 47/70 (67%), Gaps = 2/70 (2%) Frame = -3 Query: 205 VKFTYSRASPSIRWPHSKLSDIYPSTETQLPENNVLSAANTPLS--EETQKPGHAVISDE 32 VKFTY+RASPSIRWP+SKL+D+YPST+T LP+N+V + L +ET K G DE Sbjct: 74 VKFTYNRASPSIRWPNSKLTDMYPSTDTLLPQNDVFAKKTRTLDTPDETHK-GEEQQEDE 132 Query: 31 TVEAQRTRSR 2 + R+R Sbjct: 133 EETREIVRNR 142 >ref|XP_003538665.1| PREDICTED: pentatricopeptide repeat-containing protein At3g18110, chloroplastic-like [Glycine max] Length = 1476 Score = 65.9 bits (159), Expect = 3e-09 Identities = 33/69 (47%), Positives = 41/69 (59%), Gaps = 1/69 (1%) Frame = -3 Query: 205 VKFTYSRASPSIRWPHSKLSDIYPSTETQLPENNVLSAANTPL-SEETQKPGHAVISDET 29 VKF Y+RASPSIRWPH KLS YPST+ P+N++ + P S E + P V D+ Sbjct: 59 VKFIYTRASPSIRWPHLKLSQTYPSTQPHFPQNDIFPSKTPPSESPEEESPKPVVNDDDD 118 Query: 28 VEAQRTRSR 2 EAQ R Sbjct: 119 DEAQEALGR 127