BLASTX nr result
ID: Glycyrrhiza24_contig00029626
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00029626 (324 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003612353.1| Pentatricopeptide repeat-containing protein ... 108 5e-22 ref|XP_003540559.1| PREDICTED: pentatricopeptide repeat-containi... 67 1e-09 ref|XP_002307479.1| predicted protein [Populus trichocarpa] gi|2... 65 4e-09 ref|XP_003603234.1| Pentatricopeptide repeat-containing protein ... 64 2e-08 ref|XP_003523656.1| PREDICTED: pentatricopeptide repeat-containi... 63 3e-08 >ref|XP_003612353.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355513688|gb|AES95311.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 795 Score = 108 bits (270), Expect = 5e-22 Identities = 51/58 (87%), Positives = 54/58 (93%) Frame = +1 Query: 1 IGEKCAMKMIELNPSDHAPYILLSNIHIGEGKWEEALKCREKMAKIRVKKDPGSSWLI 174 IGEK AMKMIELNPSDHAPYILLSNI+I EG WEEAL CR+KMAKIRVKKDPG+SWLI Sbjct: 738 IGEKSAMKMIELNPSDHAPYILLSNIYIEEGNWEEALNCRKKMAKIRVKKDPGNSWLI 795 >ref|XP_003540559.1| PREDICTED: pentatricopeptide repeat-containing protein At3g09040, mitochondrial-like [Glycine max] Length = 916 Score = 67.4 bits (163), Expect = 1e-09 Identities = 32/83 (38%), Positives = 48/83 (57%) Frame = +1 Query: 4 GEKCAMKMIELNPSDHAPYILLSNIHIGEGKWEEALKCREKMAKIRVKKDPGSSWLI*GS 183 G++ A K+IEL P +PY+LLSN++ G W+EA R M K ++K PG SW++ G Sbjct: 811 GQRAAKKLIELEPQSSSPYVLLSNMYAASGNWDEARSLRRTMIKKDIQKIPGCSWIVVGQ 870 Query: 184 ETQYGGCYYINDSPFLECIRKIK 252 ET I+ S + E + +K Sbjct: 871 ETNLFVAGDISHSSYDEISKALK 893 >ref|XP_002307479.1| predicted protein [Populus trichocarpa] gi|222856928|gb|EEE94475.1| predicted protein [Populus trichocarpa] Length = 1026 Score = 65.5 bits (158), Expect = 4e-09 Identities = 29/62 (46%), Positives = 41/62 (66%) Frame = +1 Query: 4 GEKCAMKMIELNPSDHAPYILLSNIHIGEGKWEEALKCREKMAKIRVKKDPGSSWLI*GS 183 G++ A K+IEL P + +PY+LLSNI+ G W+E R +M + VKK PG SW++ G Sbjct: 921 GQQAAEKLIELEPQNSSPYVLLSNIYAASGNWDEVNTLRREMREKGVKKLPGCSWIVVGQ 980 Query: 184 ET 189 ET Sbjct: 981 ET 982 >ref|XP_003603234.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355492282|gb|AES73485.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 973 Score = 63.5 bits (153), Expect = 2e-08 Identities = 26/56 (46%), Positives = 38/56 (67%) Frame = +1 Query: 4 GEKCAMKMIELNPSDHAPYILLSNIHIGEGKWEEALKCREKMAKIRVKKDPGSSWL 171 GE+ A K+ ++PSD A Y+LLSNI+ +WE A+ R M ++ VKK+PG SW+ Sbjct: 789 GERVAEKLFTMDPSDSAAYVLLSNIYAAANQWENAVSARNMMKRVNVKKEPGFSWI 844 >ref|XP_003523656.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33170-like [Glycine max] Length = 1611 Score = 62.8 bits (151), Expect = 3e-08 Identities = 26/56 (46%), Positives = 36/56 (64%) Frame = +1 Query: 4 GEKCAMKMIELNPSDHAPYILLSNIHIGEGKWEEALKCREKMAKIRVKKDPGSSWL 171 G++ A K++ L PSD A Y+LLSN++ +WE R M K+ VKKDPG SW+ Sbjct: 1427 GKRVAEKLLALEPSDSAAYVLLSNVYAAANQWENVASARNMMRKVNVKKDPGFSWV 1482