BLASTX nr result
ID: Glycyrrhiza24_contig00029588
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00029588 (302 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003622494.1| WRKY transcription factor [Medicago truncatu... 58 7e-07 >ref|XP_003622494.1| WRKY transcription factor [Medicago truncatula] gi|355497509|gb|AES78712.1| WRKY transcription factor [Medicago truncatula] Length = 338 Score = 58.2 bits (139), Expect = 7e-07 Identities = 35/52 (67%), Positives = 37/52 (71%), Gaps = 6/52 (11%) Frame = -2 Query: 301 EEENEFGSSDNMVVTDDFFEGLDELTGFA----TAATGDCFC*PFC--IVLP 164 EEENEF SD MVVTDDFFEGLDELTGFA ++ GDCF PF I LP Sbjct: 283 EEENEFELSD-MVVTDDFFEGLDELTGFAGKTVASSGGDCFGDPFAASIALP 333