BLASTX nr result
ID: Glycyrrhiza24_contig00029514
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00029514 (331 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAD22368.1| putative non-LTR retroelement reverse transcripta... 42 8e-06 >gb|AAD22368.1| putative non-LTR retroelement reverse transcriptase [Arabidopsis thaliana] Length = 321 Score = 42.4 bits (98), Expect(2) = 8e-06 Identities = 21/36 (58%), Positives = 24/36 (66%), Gaps = 1/36 (2%) Frame = +2 Query: 161 PPDG*WTKCNSDGSLAGN-GVATCGGVLRDSYGRWL 265 P DG W K N+DG+ GN G AT GGVLRD G W+ Sbjct: 156 PEDG-WVKLNTDGASRGNPGFATAGGVLRDHNGAWI 190 Score = 32.0 bits (71), Expect(2) = 8e-06 Identities = 12/24 (50%), Positives = 16/24 (66%) Frame = +3 Query: 258 GGFSQRLGTCSVLMAELWGILTSL 329 GGF+ +G CS +AELWG+ L Sbjct: 191 GGFAVNIGVCSAPLAELWGVYYGL 214