BLASTX nr result
ID: Glycyrrhiza24_contig00029451
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00029451 (283 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_001236039.1| with no lysine kinase [Glycine max] gi|22534... 57 2e-06 ref|NP_001236053.1| with no lysine kinase 7 [Glycine max] gi|225... 55 8e-06 >ref|NP_001236039.1| with no lysine kinase [Glycine max] gi|225348635|gb|ACN87279.1| with no lysine kinase [Glycine max] Length = 569 Score = 57.0 bits (136), Expect = 2e-06 Identities = 24/33 (72%), Positives = 29/33 (87%) Frame = -1 Query: 283 HKLAISDLLKDLSQEMCQKVLNMCNLHIPDGEM 185 HKLA+SDLL ++ EMCQKVLN+CNL +PDGEM Sbjct: 531 HKLAVSDLLMEIPPEMCQKVLNVCNLQMPDGEM 563 >ref|NP_001236053.1| with no lysine kinase 7 [Glycine max] gi|225348643|gb|ACN87283.1| with no lysine kinase [Glycine max] Length = 567 Score = 54.7 bits (130), Expect = 8e-06 Identities = 23/33 (69%), Positives = 28/33 (84%) Frame = -1 Query: 283 HKLAISDLLKDLSQEMCQKVLNMCNLHIPDGEM 185 HKLA+SDLL ++ EMCQKVLN+CNL +PD EM Sbjct: 529 HKLAVSDLLMEIPPEMCQKVLNICNLQMPDSEM 561