BLASTX nr result
ID: Glycyrrhiza24_contig00029346
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00029346 (292 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003552546.1| PREDICTED: pentatricopeptide repeat-containi... 87 1e-15 ref|XP_003530418.1| PREDICTED: pentatricopeptide repeat-containi... 86 4e-15 ref|XP_003621319.1| Pentatricopeptide repeat-containing protein ... 69 3e-10 ref|XP_002532904.1| pentatricopeptide repeat-containing protein,... 60 2e-07 ref|XP_002305377.1| predicted protein [Populus trichocarpa] gi|2... 59 5e-07 >ref|XP_003552546.1| PREDICTED: pentatricopeptide repeat-containing protein At3g29230-like [Glycine max] Length = 604 Score = 87.0 bits (214), Expect = 1e-15 Identities = 42/61 (68%), Positives = 47/61 (77%) Frame = -3 Query: 290 LQMKITGGQKPXXXXXXXXXXXVHQFTVFDQSHPKSEDIYDMVDRLVQDLRQVGYVPGIH 111 LQMK TGG+KP VH+FTVFDQSHPKS+DIY M+DRLVQDLRQVGYVP IH Sbjct: 544 LQMKNTGGEKPSGASSIEVEEEVHEFTVFDQSHPKSDDIYQMIDRLVQDLRQVGYVPMIH 603 Query: 110 R 108 + Sbjct: 604 Q 604 >ref|XP_003530418.1| PREDICTED: pentatricopeptide repeat-containing protein At3g29230-like [Glycine max] Length = 604 Score = 85.5 bits (210), Expect = 4e-15 Identities = 42/61 (68%), Positives = 46/61 (75%) Frame = -3 Query: 290 LQMKITGGQKPXXXXXXXXXXXVHQFTVFDQSHPKSEDIYDMVDRLVQDLRQVGYVPGIH 111 LQM TGGQKP VH+FTVFDQSHPKS+DIY M+DRLVQDLRQVGYVP IH Sbjct: 544 LQMMNTGGQKPSGASSIEVEEEVHEFTVFDQSHPKSDDIYKMIDRLVQDLRQVGYVPMIH 603 Query: 110 R 108 + Sbjct: 604 Q 604 >ref|XP_003621319.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355496334|gb|AES77537.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 605 Score = 69.3 bits (168), Expect = 3e-10 Identities = 35/56 (62%), Positives = 38/56 (67%) Frame = -3 Query: 287 QMKITGGQKPXXXXXXXXXXXVHQFTVFDQSHPKSEDIYDMVDRLVQDLRQVGYVP 120 QM GGQKP VH+FTV D SHPKS DIY+M+DRLV DLRQVGYVP Sbjct: 547 QMNDEGGQKPSGVSSIEVEEEVHEFTVRDWSHPKSGDIYNMIDRLVHDLRQVGYVP 602 >ref|XP_002532904.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223527338|gb|EEF29484.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 604 Score = 59.7 bits (143), Expect = 2e-07 Identities = 29/57 (50%), Positives = 38/57 (66%) Frame = -3 Query: 290 LQMKITGGQKPXXXXXXXXXXXVHQFTVFDQSHPKSEDIYDMVDRLVQDLRQVGYVP 120 LQMK TG QKP VH+FTVFD+SHP+++ IY ++ +L QDL+QV Y P Sbjct: 544 LQMKSTGVQKPSGASSIELDDEVHEFTVFDKSHPETDKIYQILVKLGQDLKQVAYAP 600 >ref|XP_002305377.1| predicted protein [Populus trichocarpa] gi|222848341|gb|EEE85888.1| predicted protein [Populus trichocarpa] Length = 427 Score = 58.5 bits (140), Expect = 5e-07 Identities = 30/60 (50%), Positives = 39/60 (65%) Frame = -3 Query: 290 LQMKITGGQKPXXXXXXXXXXXVHQFTVFDQSHPKSEDIYDMVDRLVQDLRQVGYVPGIH 111 LQMK G QKP VH+FTVFD+SHPKS+ IY M++RL DL++V VP ++ Sbjct: 367 LQMKNFGIQKPSGASSIEVDDEVHEFTVFDKSHPKSDKIYQMINRLGLDLKRVHVVPKVY 426