BLASTX nr result
ID: Glycyrrhiza24_contig00029257
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00029257 (211 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_001241479.1| uncharacterized protein LOC100794851 [Glycin... 63 3e-08 ref|XP_003519322.1| PREDICTED: zinc finger protein 4-like isofor... 60 1e-07 >ref|NP_001241479.1| uncharacterized protein LOC100794851 [Glycine max] gi|255635712|gb|ACU18205.1| unknown [Glycine max] Length = 257 Score = 62.8 bits (151), Expect = 3e-08 Identities = 34/47 (72%), Positives = 37/47 (78%), Gaps = 6/47 (12%) Frame = -1 Query: 124 MKPNFDLEVEATAEYESEVCSQVASNISIHETSV------VTNSSNI 2 MKPNFDLEVEA AEYESEV SQVASN+SI ETS+ +TN SNI Sbjct: 1 MKPNFDLEVEACAEYESEVSSQVASNVSIQETSIGPCSDSLTNISNI 47 >ref|XP_003519322.1| PREDICTED: zinc finger protein 4-like isoform 1 [Glycine max] gi|356501011|ref|XP_003519323.1| PREDICTED: zinc finger protein 4-like isoform 2 [Glycine max] Length = 257 Score = 60.5 bits (145), Expect = 1e-07 Identities = 33/47 (70%), Positives = 36/47 (76%), Gaps = 6/47 (12%) Frame = -1 Query: 124 MKPNFDLEVEATAEYESEVCSQVASNISIHETSV------VTNSSNI 2 MKPNFDLEVEA A YESEV SQVASN+SI ETS+ +TN SNI Sbjct: 1 MKPNFDLEVEACAAYESEVSSQVASNVSIQETSIGPCSDSLTNISNI 47