BLASTX nr result
ID: Glycyrrhiza24_contig00029092
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00029092 (275 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003553338.1| PREDICTED: ALA-interacting subunit 3-like [G... 60 1e-07 ref|XP_003546949.1| PREDICTED: ALA-interacting subunit 1-like [G... 59 5e-07 gb|AFK47633.1| unknown [Medicago truncatula] 55 5e-06 ref|XP_003597705.1| Cell division control protein [Medicago trun... 55 5e-06 ref|XP_003542093.1| PREDICTED: LOW QUALITY PROTEIN: ALA-interact... 55 6e-06 >ref|XP_003553338.1| PREDICTED: ALA-interacting subunit 3-like [Glycine max] Length = 349 Score = 60.5 bits (145), Expect = 1e-07 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = -2 Query: 274 LAVAFLVLYVMKPRPLGDPTYLSWNRYPGSLR 179 LA AFL+LYVM+PRPLGDP+YLSWN+ PGSLR Sbjct: 318 LAAAFLLLYVMQPRPLGDPSYLSWNKNPGSLR 349 >ref|XP_003546949.1| PREDICTED: ALA-interacting subunit 1-like [Glycine max] Length = 344 Score = 58.5 bits (140), Expect = 5e-07 Identities = 23/31 (74%), Positives = 30/31 (96%) Frame = -2 Query: 271 AVAFLVLYVMKPRPLGDPTYLSWNRYPGSLR 179 A+AF++LYV+KPRPLGDP+YLSWNR PGS++ Sbjct: 314 AIAFILLYVIKPRPLGDPSYLSWNRNPGSMK 344 >gb|AFK47633.1| unknown [Medicago truncatula] Length = 347 Score = 55.5 bits (132), Expect = 5e-06 Identities = 22/31 (70%), Positives = 28/31 (90%) Frame = -2 Query: 271 AVAFLVLYVMKPRPLGDPTYLSWNRYPGSLR 179 A+ F++LYV+KPRPLGDP+YLSWNR PG L+ Sbjct: 317 AIGFILLYVVKPRPLGDPSYLSWNRNPGILK 347 >ref|XP_003597705.1| Cell division control protein [Medicago truncatula] gi|355486753|gb|AES67956.1| Cell division control protein [Medicago truncatula] Length = 347 Score = 55.5 bits (132), Expect = 5e-06 Identities = 22/31 (70%), Positives = 28/31 (90%) Frame = -2 Query: 271 AVAFLVLYVMKPRPLGDPTYLSWNRYPGSLR 179 A+ F++LYV+KPRPLGDP+YLSWNR PG L+ Sbjct: 317 AIGFILLYVVKPRPLGDPSYLSWNRNPGILK 347 >ref|XP_003542093.1| PREDICTED: LOW QUALITY PROTEIN: ALA-interacting subunit 3-like [Glycine max] Length = 334 Score = 55.1 bits (131), Expect = 6e-06 Identities = 21/31 (67%), Positives = 28/31 (90%) Frame = -2 Query: 271 AVAFLVLYVMKPRPLGDPTYLSWNRYPGSLR 179 A+ F++LYV+KPRPLGDP+YL WNR PGS++ Sbjct: 304 AIGFILLYVIKPRPLGDPSYLPWNRNPGSIK 334