BLASTX nr result
ID: Glycyrrhiza24_contig00029056
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00029056 (424 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002528111.1| conserved hypothetical protein [Ricinus comm... 64 1e-08 emb|CAN77490.1| hypothetical protein VITISV_010725 [Vitis vinifera] 62 4e-08 ref|XP_002279742.2| PREDICTED: uncharacterized protein LOC100254... 62 5e-08 emb|CBI30400.3| unnamed protein product [Vitis vinifera] 62 5e-08 ref|XP_003530277.1| PREDICTED: uncharacterized protein LOC100817... 55 6e-06 >ref|XP_002528111.1| conserved hypothetical protein [Ricinus communis] gi|223532500|gb|EEF34290.1| conserved hypothetical protein [Ricinus communis] Length = 513 Score = 64.3 bits (155), Expect = 1e-08 Identities = 32/43 (74%), Positives = 34/43 (79%) Frame = -1 Query: 367 PLATSSTASSEPSVNNNSNMSYGSEIEGNDFGSERGNSSPISH 239 PLATSS ASSEPSVNNNS + G E+E NDFGSE GN SP SH Sbjct: 468 PLATSSNASSEPSVNNNSLFADGIEMEVNDFGSENGNCSPTSH 510 >emb|CAN77490.1| hypothetical protein VITISV_010725 [Vitis vinifera] Length = 569 Score = 62.4 bits (150), Expect = 4e-08 Identities = 31/48 (64%), Positives = 37/48 (77%) Frame = -1 Query: 367 PLATSSTASSEPSVNNNSNMSYGSEIEGNDFGSERGNSSPISHQM*KM 224 PLATSS SSEPSVN NS+ YGSEIE ++ GS+RG+SSP S Q K+ Sbjct: 480 PLATSSITSSEPSVNENSHCFYGSEIEDDELGSDRGHSSPASRQAGKV 527 >ref|XP_002279742.2| PREDICTED: uncharacterized protein LOC100254532 [Vitis vinifera] Length = 516 Score = 62.0 bits (149), Expect = 5e-08 Identities = 30/44 (68%), Positives = 35/44 (79%) Frame = -1 Query: 367 PLATSSTASSEPSVNNNSNMSYGSEIEGNDFGSERGNSSPISHQ 236 PLATSS SSEPSVN NS+ YGSEIE ++ GS+RG+SSP S Q Sbjct: 471 PLATSSITSSEPSVNENSHCFYGSEIEDDELGSDRGHSSPASRQ 514 >emb|CBI30400.3| unnamed protein product [Vitis vinifera] Length = 132 Score = 62.0 bits (149), Expect = 5e-08 Identities = 30/44 (68%), Positives = 35/44 (79%) Frame = -1 Query: 367 PLATSSTASSEPSVNNNSNMSYGSEIEGNDFGSERGNSSPISHQ 236 PLATSS SSEPSVN NS+ YGSEIE ++ GS+RG+SSP S Q Sbjct: 87 PLATSSITSSEPSVNENSHCFYGSEIEDDELGSDRGHSSPASRQ 130 >ref|XP_003530277.1| PREDICTED: uncharacterized protein LOC100817222 [Glycine max] Length = 537 Score = 55.1 bits (131), Expect = 6e-06 Identities = 28/38 (73%), Positives = 30/38 (78%) Frame = -1 Query: 367 PLATSSTASSEPSVNNNSNMSYGSEIEGNDFGSERGNS 254 PLATSST SSEPSVNN+S GSE E NDF SE+GNS Sbjct: 500 PLATSSTTSSEPSVNNSSISYDGSEAEENDFASEKGNS 537