BLASTX nr result
ID: Glycyrrhiza24_contig00028923
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00028923 (371 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003529386.1| PREDICTED: nodulation protein H-like [Glycin... 64 1e-08 ref|XP_003518849.1| PREDICTED: nodulation protein H-like [Glycin... 64 1e-08 ref|XP_003608017.1| Nodulation protein H [Medicago truncatula] g... 63 3e-08 >ref|XP_003529386.1| PREDICTED: nodulation protein H-like [Glycine max] Length = 344 Score = 63.9 bits (154), Expect = 1e-08 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = +1 Query: 1 KGSLSSQVENWNDVSKALTGTQYENFLREDYRR 99 KGSLSSQVENWND+SKALTGT YE+F+ EDYRR Sbjct: 312 KGSLSSQVENWNDISKALTGTPYESFIHEDYRR 344 >ref|XP_003518849.1| PREDICTED: nodulation protein H-like [Glycine max] Length = 344 Score = 63.9 bits (154), Expect = 1e-08 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = +1 Query: 1 KGSLSSQVENWNDVSKALTGTQYENFLREDYRR 99 KGSLSSQVENWND+SKALTGT YE+F+ EDYRR Sbjct: 312 KGSLSSQVENWNDISKALTGTPYESFIHEDYRR 344 >ref|XP_003608017.1| Nodulation protein H [Medicago truncatula] gi|355509072|gb|AES90214.1| Nodulation protein H [Medicago truncatula] Length = 344 Score = 62.8 bits (151), Expect = 3e-08 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = +1 Query: 1 KGSLSSQVENWNDVSKALTGTQYENFLREDYRR 99 KGSLSSQVENWNDV+K L GTQYE+FL EDYRR Sbjct: 312 KGSLSSQVENWNDVTKTLNGTQYESFLHEDYRR 344