BLASTX nr result
ID: Glycyrrhiza24_contig00028786
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00028786 (450 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002319711.1| predicted protein [Populus trichocarpa] gi|2... 51 1e-07 ref|XP_002270888.1| PREDICTED: ankyrin-2-like [Vitis vinifera] 50 1e-07 emb|CAN63755.1| hypothetical protein VITISV_005666 [Vitis vinifera] 50 1e-07 emb|CBI31234.3| unnamed protein product [Vitis vinifera] 50 1e-07 gb|ACU00619.1| penetration and arbuscule morphogenesis protein [... 47 2e-07 >ref|XP_002319711.1| predicted protein [Populus trichocarpa] gi|222858087|gb|EEE95634.1| predicted protein [Populus trichocarpa] Length = 429 Score = 50.8 bits (120), Expect(2) = 1e-07 Identities = 25/36 (69%), Positives = 29/36 (80%) Frame = -2 Query: 242 SSSTPLEAACSSGEALIVELLLARKAHTQRSEESKW 135 S +PLEAA SGEALIVELLLAR+A T+RS+ S W Sbjct: 97 SGYSPLEAAARSGEALIVELLLARRASTERSQSSTW 132 Score = 30.0 bits (66), Expect(2) = 1e-07 Identities = 17/27 (62%), Positives = 20/27 (74%) Frame = -1 Query: 348 TLLKLAIPQRRPDLVRSVQLLLKFEPN 268 TLL LAI Q R D+ VQLLL+FEP+ Sbjct: 67 TLLHLAISQSRADI---VQLLLEFEPD 90 >ref|XP_002270888.1| PREDICTED: ankyrin-2-like [Vitis vinifera] Length = 532 Score = 50.1 bits (118), Expect(2) = 1e-07 Identities = 28/41 (68%), Positives = 33/41 (80%) Frame = -2 Query: 263 EAPNRYDSSSTPLEAACSSGEALIVELLLARKAHTQRSEES 141 EA +R S STPLEAA +SGEALIVELLLA +A T+RS+ S Sbjct: 193 EAQSR--SGSTPLEAAAASGEALIVELLLAHRASTERSQSS 231 Score = 30.4 bits (67), Expect(2) = 1e-07 Identities = 18/27 (66%), Positives = 20/27 (74%) Frame = -1 Query: 348 TLLKLAIPQRRPDLVRSVQLLLKFEPN 268 TLL LAI Q R DL VQLLL+FEP+ Sbjct: 168 TLLHLAITQGRADL---VQLLLEFEPD 191 >emb|CAN63755.1| hypothetical protein VITISV_005666 [Vitis vinifera] Length = 532 Score = 50.1 bits (118), Expect(2) = 1e-07 Identities = 28/41 (68%), Positives = 33/41 (80%) Frame = -2 Query: 263 EAPNRYDSSSTPLEAACSSGEALIVELLLARKAHTQRSEES 141 EA +R S STPLEAA +SGEALIVELLLA +A T+RS+ S Sbjct: 193 EAQSR--SGSTPLEAAAASGEALIVELLLAHRASTERSQSS 231 Score = 30.4 bits (67), Expect(2) = 1e-07 Identities = 18/27 (66%), Positives = 20/27 (74%) Frame = -1 Query: 348 TLLKLAIPQRRPDLVRSVQLLLKFEPN 268 TLL LAI Q R DL VQLLL+FEP+ Sbjct: 168 TLLHLAITQGRADL---VQLLLEFEPD 191 >emb|CBI31234.3| unnamed protein product [Vitis vinifera] Length = 407 Score = 50.1 bits (118), Expect(2) = 1e-07 Identities = 28/41 (68%), Positives = 33/41 (80%) Frame = -2 Query: 263 EAPNRYDSSSTPLEAACSSGEALIVELLLARKAHTQRSEES 141 EA +R S STPLEAA +SGEALIVELLLA +A T+RS+ S Sbjct: 68 EAQSR--SGSTPLEAAAASGEALIVELLLAHRASTERSQSS 106 Score = 30.4 bits (67), Expect(2) = 1e-07 Identities = 18/27 (66%), Positives = 20/27 (74%) Frame = -1 Query: 348 TLLKLAIPQRRPDLVRSVQLLLKFEPN 268 TLL LAI Q R DL VQLLL+FEP+ Sbjct: 43 TLLHLAITQGRADL---VQLLLEFEPD 66 >gb|ACU00619.1| penetration and arbuscule morphogenesis protein [Petunia x hybrida] Length = 535 Score = 47.0 bits (110), Expect(2) = 2e-07 Identities = 24/34 (70%), Positives = 30/34 (88%) Frame = -2 Query: 242 SSSTPLEAACSSGEALIVELLLARKAHTQRSEES 141 S S+PLEAA ++GEALIVELLLA+KA T+R+E S Sbjct: 205 SCSSPLEAASATGEALIVELLLAKKASTERTEFS 238 Score = 32.7 bits (73), Expect(2) = 2e-07 Identities = 19/27 (70%), Positives = 20/27 (74%) Frame = -1 Query: 348 TLLKLAIPQRRPDLVRSVQLLLKFEPN 268 TLL LAI Q RPDL VQLLL+F PN Sbjct: 175 TLLHLAISQGRPDL---VQLLLEFGPN 198