BLASTX nr result
ID: Glycyrrhiza24_contig00028764
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00028764 (216 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003527867.1| PREDICTED: pentatricopeptide repeat-containi... 124 1e-26 ref|XP_003602939.1| Pentatricopeptide repeat-containing protein ... 112 2e-23 ref|XP_004136259.1| PREDICTED: pentatricopeptide repeat-containi... 109 2e-22 ref|XP_003523776.1| PREDICTED: LOW QUALITY PROTEIN: pentatricope... 109 3e-22 ref|XP_002283907.2| PREDICTED: pentatricopeptide repeat-containi... 107 1e-21 >ref|XP_003527867.1| PREDICTED: pentatricopeptide repeat-containing protein At5g18475-like [Glycine max] Length = 546 Score = 124 bits (310), Expect = 1e-26 Identities = 58/72 (80%), Positives = 68/72 (94%) Frame = -1 Query: 216 HYSKSSLHEKVLRMFFAIQPIVREKPSPKAISTCLNLLVESNRVDLARQLLLHAKRTLTY 37 H+SKSSLHEK+L +F+IQPIVREKPSPKA+STCLNLL++SNRVDLAR+LLLHAKR LT Sbjct: 170 HFSKSSLHEKLLHAYFSIQPIVREKPSPKALSTCLNLLLDSNRVDLARKLLLHAKRDLTR 229 Query: 36 RPNVCIFNILVK 1 +PNVC+FNILVK Sbjct: 230 KPNVCVFNILVK 241 >ref|XP_003602939.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355491987|gb|AES73190.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 586 Score = 112 bits (281), Expect = 2e-23 Identities = 54/72 (75%), Positives = 62/72 (86%) Frame = -1 Query: 216 HYSKSSLHEKVLRMFFAIQPIVREKPSPKAISTCLNLLVESNRVDLARQLLLHAKRTLTY 37 HYSK HEKV F +IQ IVREKPSPKAIS+CLNLLV+SN+VDL R+LLL+AKR+L Y Sbjct: 210 HYSKCGFHEKVFDAFLSIQTIVREKPSPKAISSCLNLLVDSNQVDLVRKLLLYAKRSLVY 269 Query: 36 RPNVCIFNILVK 1 +PNVCIFNILVK Sbjct: 270 KPNVCIFNILVK 281 >ref|XP_004136259.1| PREDICTED: pentatricopeptide repeat-containing protein At5g18475-like [Cucumis sativus] gi|449497032|ref|XP_004160294.1| PREDICTED: pentatricopeptide repeat-containing protein At5g18475-like [Cucumis sativus] Length = 504 Score = 109 bits (273), Expect = 2e-22 Identities = 54/72 (75%), Positives = 64/72 (88%) Frame = -1 Query: 216 HYSKSSLHEKVLRMFFAIQPIVREKPSPKAISTCLNLLVESNRVDLARQLLLHAKRTLTY 37 H+SKSS+HE+VL MF+AI+ IVREKPS KAISTCLNLLVES+RVDLAR+LL++A+ L Sbjct: 127 HFSKSSMHERVLDMFYAIKSIVREKPSLKAISTCLNLLVESDRVDLARKLLVNARSKLNL 186 Query: 36 RPNVCIFNILVK 1 RPN CIFNILVK Sbjct: 187 RPNTCIFNILVK 198 >ref|XP_003523776.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At5g18475-like [Glycine max] Length = 640 Score = 109 bits (272), Expect = 3e-22 Identities = 54/72 (75%), Positives = 62/72 (86%) Frame = -1 Query: 216 HYSKSSLHEKVLRMFFAIQPIVREKPSPKAISTCLNLLVESNRVDLARQLLLHAKRTLTY 37 H+SKSS+HEKVL FF+IQPIVREKP STCLNLL +SNRVDLAR+LLLHAKR LT+ Sbjct: 131 HFSKSSIHEKVLHAFFSIQPIVREKPX----STCLNLLQDSNRVDLARKLLLHAKRGLTH 186 Query: 36 RPNVCIFNILVK 1 +PN C+FNILVK Sbjct: 187 KPNTCVFNILVK 198 >ref|XP_002283907.2| PREDICTED: pentatricopeptide repeat-containing protein At5g18475-like [Vitis vinifera] Length = 513 Score = 107 bits (266), Expect = 1e-21 Identities = 52/72 (72%), Positives = 62/72 (86%) Frame = -1 Query: 216 HYSKSSLHEKVLRMFFAIQPIVREKPSPKAISTCLNLLVESNRVDLARQLLLHAKRTLTY 37 H+SK SLHE+V+ MF AI+PIVREKPS KAISTCLNLLVESN+VDL R+ LL++K++L Sbjct: 137 HFSKLSLHERVVEMFDAIRPIVREKPSLKAISTCLNLLVESNQVDLTRKFLLNSKKSLNL 196 Query: 36 RPNVCIFNILVK 1 PN CIFNILVK Sbjct: 197 EPNTCIFNILVK 208